DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and AMS1

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_011359.1 Gene:AMS1 SGDID:S000003124 Length:1083 Species:Saccharomyces cerevisiae

Alignment Length:902 Identity:189/903 (21%)
Similarity:318/903 (35%) Gaps:219/903 (24%)


  Fly    94 QCQDVVQDVPNVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPG 158
            :|::::|         .|.:|  ||.: ...|::||          .:.....|:.:.:.|.|..
Yeast   260 KCRELLQ---------REYFD--SFLE-SSKVYEQG----------ESQVLTNVYGIGNCHIDTA 302

  Fly   159 WIQTFEEYYQHDTKHILSNALRHLHDN-PEMKFIWAEISYFARFYHDLGE--NKKLQMKSIVKNG 220
            |:..|.|..:...:...|...  |.|. ||.||:.::...|.....|..|  ||.|..|  ::..
Yeast   303 WLWPFAETRRKIVRSWSSQCT--LMDRFPEYKFVASQAQQFKWLLEDHPEFFNKVLIPK--IQQS 363

  Fly   221 QLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGF 285
            |...|.|.||..|.......::..|...||.:..:...:.....|..|.||:|..||.:.:.||.
Yeast   364 QFFAVGGTWVENDTNIPSGESLARQFFFGQRFFLKHFGLKSKIFWLPDTFGYSSQMPQLCRLSGI 428

  Fly   286 KNMLIQRTHYSVKKELAQQRQLEFLWRQI---------WDNKGDTALFTHMMPFYSYDIPHTCGP 341
            ...|.|:                ..|..|         |.....:.|.|||.|..:|......| 
Yeast   429 DKFLTQK----------------LSWNNINSFPHSTFNWAGIDGSQLLTHMPPGNTYTADSHFG- 476

  Fly   342 DPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDF 406
                    |..|                .:.||             |..|.|.:.::|...||. 
Yeast   477 --------DVLR----------------TAKQN-------------KTPEYYGSGLMLYGKGDG- 503

  Fly   407 RFKQNTEWDVQRVNYERLFEHINSQAHFNV--QAQFG-TLQEYFDAVHQAERAGQAEFPTLSGDF 468
             ....||..:|::...|...:.|.    ||  :.|.| |:.|::|.:.:....|. :.||.||:.
Yeast   504 -GGGPTEEMLQKMRRIRSMNNRNG----NVIPKLQVGITVDEFYDDILKRTNQGH-DLPTWSGEL 562

  Fly   469 FTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRAAEMLSAWHSW---DGMARIEERLEQARRELS 530
            :.      .:..|.|||:...|::.|:....:...|.::|..|.   |......:::.:....:.
Yeast   563 YF------EFHRGTYTSQAQTKKLMRLSEIKLHDLEWIAAKTSVLYPDSYKYPSKQINELWENVL 621

  Fly   531 LFQHHDGITGTAKTHVVVDYE--QRMQEALKACQMVMQQSV-------------YRLLT--KPSI 578
            |.|.||.:.|:. ..:|..||  ..:...:|.|..::.::|             .|.||  ||..
Yeast   622 LCQFHDVLPGSC-IEMVYKYEAVPMLHNVVKECTSLIDKTVQFLQSQSKADLVEMRTLTWSKPEK 685

  Fly   579 YSPDFSFS------------YFTLDDSR-----WPGSGVEDSRTTIILGEDILPSKH-------- 618
            .|.:.|.:            |..|.:.:     ...:||..|.|...||.:.|.::|        
Yeast   686 VSEECSLNGSYTSSVTGYDDYIVLANGKLKVIICKKTGVITSITDETLGVEYLDTEHGRNKLGAN 750

  Fly   619 -VVMHNTLP----HWREQLVDF----YVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQ 674
             .|:::..|    .|..:|...    ||:.| ..|....|...:..|..::........|::...
Yeast   751 QFVIYDDKPLGWQAWDTELYSVNQYKYVTKP-KKVQVSCNTKEKCAVEVIFQISEKCKIKSVISL 814

  Fly   675 GSTTKYRIIFKARVPPMGLATYV---------LTIS---DSKPEHTSYASNLLLRKNP----TSL 723
            .:|.    :..|::..:.::|.|         |.:.   :.:.:..||.:...:.|.|    ||.
Yeast   815 NATA----VTDAKLSKVDISTTVENWDARNKFLKVEFPVNIRNDFASYETQFGITKRPTHYNTSW 875

  Fly   724 PLGQYPEDV---KFGDPREISLRVG--NGPTLAFSEQGLLKSIQLTQDSPHVP-VHFKF----LK 778
            .:.::  :|   ||.|..|.|..|.  |.....||..|.|..:.|.: ||..| .|...    :|
Yeast   876 DVAKF--EVCHHKFADYSEYSKGVSILNDCKYGFSTHGNLMRLSLLR-SPKAPDAHADMGTHEIK 937

  Fly   779 YGVRSHGDRSGAYLFLPNGPASPVELGQPVVLVTKGKLESSVSV---------GLPSVVHQTIMR 834
            |.:..|   .||.      .:..|:|........|.||...:.:         |..:|:...|.|
Yeast   938 YAIYPH---RGAL------SSDTVKLAHEFNYCFKYKLPKDIGMNFDDIISISGDENVILSNIKR 993

  Fly   835 G-GAPEIRNLVDIGSLDNTEIVMRLETHIDSGDIFYTDLNGLQFIKR-RRLDKLPLQ 889
            | ....:::...:...|...||:|:...:  |...:..||....:|| .::|.|.::
Yeast   994 GEDDSAVKSNYSLNPRDEQSIVVRVYESL--GGESFASLNTTLNLKRIEKVDNLEMK 1048

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 78/354 (22%)
Alpha-mann_mid 478..554 CDD:214875 18/81 (22%)
Glyco_hydro_38C 744..1103 CDD:285047 37/165 (22%)
AMS1NP_011359.1 AMS1 44..1083 CDD:223460 189/903 (21%)
GH38N_AMII_ScAms1_like 290..548 CDD:212123 72/322 (22%)
Alpha-mann_mid 565..646 CDD:286360 18/82 (22%)
Glyco_hydro_38C 672..1079 CDD:285047 82/397 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65919859
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3970
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.