DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and man2a1

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_001103497.2 Gene:man2a1 ZFINID:ZDB-GENE-060526-31 Length:1150 Species:Danio rerio

Alignment Length:1177 Identity:451/1178 (38%)
Similarity:646/1178 (55%) Gaps:175/1178 (15%)


  Fly     2 LRIRRRFALVICSG--CLLVFLSLYIILNFAAPAATQIKQPNYENIEN--------KLHELENGL 56
            :::.|:|. |..|.  |::|| |||::|:.    ....|.||.|.|:|        |:..||..|
Zfish     1 MKLSRQFT-VFGSAIFCVVVF-SLYLMLDH----IDHSKNPNGERIQNGQIGILQDKIDHLERLL 59

  Fly    57 QEHGEEMRNLR---ARLAETSNRDDPIRPPLKVARS------PRPG-------QCQDVVQDVPNV 105
            .|:.|.:.|:|   ..|.||. :|..:.|...:::.      |.|.       .||...:.....
Zfish    60 AENNEIIGNIRDSVINLRETV-KDGKMFPEANMSQGNLELLPPAPALLPILSDDCQFAGRTYSKA 123

  Fly   106 --DVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQ 168
              .||||::||.:.|.:.||||||||::|.|...::: :..|:|||||||||||||::||::||:
Zfish   124 ADGVQMLDVYDLLRFDNPDGGVWKQGFDISYQENEWD-NEPLQVFVVPHSHNDPGWLKTFDDYYR 187

  Fly   169 HDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPD 233
            ..|:|||:|.:..||::...|.||:||||||:::..:...|:..::.:|:|||||..||||||||
Zfish   188 DQTQHILNNMVVKLHEDSRRKMIWSEISYFAKWWDSIDGQKQDAVRRLVENGQLEVATGGWVMPD 252

  Fly   234 EANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVK 298
            |||:|:..::.||.||..||::.:.|.|...||:|||||:.|..|:|:.:|..||||||.|||||
Zfish   253 EANAHYFAMIDQLVEGHQWLERNLGVKPKTGWAVDPFGHTATQAYLLKLAGLSNMLIQRVHYSVK 317

  Fly   299 KELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPW 363
            |..:.|:.|||.|||.||....|.:..|||||||||:|||||||||:||||||||:....:||||
Zfish   318 KHFSSQKTLEFFWRQNWDQDSSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRISCPW 382

  Fly   364 KVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHI 428
            ::||:.|:|.||..|:..|:||::||::|:||.|||.|||||||:.:..|||.|..||::||:::
Zfish   383 RIPPQAITDNNVQERAQTLLDQYRKKSKLFRTKVLLAPLGDDFRYTEAVEWDQQFENYQKLFDYM 447

  Fly   429 NSQAHFNVQAQFGTLQEYFDAVHQAE-------RAGQAEFPTLSGDFFTYADRSDNYWSGYYTSR 486
            ||....:|:|||||:.:||.|:.::.       ..|....|.:||||||||||.|:|||||:|||
Zfish   448 NSHPELHVKAQFGTISDYFQALRKSTGMDPVGMNVGHLALPVVSGDFFTYADRDDHYWSGYFTSR 512

  Fly   487 PYHKRMDRVLMHYVRAAEMLSAWHSWDGMARIE--------------ERLEQARRELSLFQHHDG 537
            |::|||||:|..|:||||:|.:.    .:|.|:              :.|.:|||.|.||||||.
Zfish   513 PFYKRMDRMLESYLRAAEVLYSL----TLANIQKYGQPSDYPAGENYKLLTEARRNLGLFQHHDA 573

  Fly   538 ITGTAKTHVVVDYEQRMQEALKACQMVMQQSVYRLLTK-PSIYSPDFSFSYFTLDDSRWPGSGVE 601
            |.||.|..|||||..|:..::...:.|:..|.:.|:.| ...|..|.|.::..:||       |:
Zfish   574 IAGTGKDWVVVDYGTRLFHSILNVKRVIVSSAHWLVLKDKQTYHNDPSKAFLQMDD-------VQ 631

  Fly   602 DSRTTIILGEDILPSKHV----------VMHNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQV 656
            .|       :|.||.|:|          |:.|.|...|..:|..||::|.|.|.......|.|||
Zfish   632 QS-------QDALPRKNVLEVHGKPRLLVVSNPLEQARTSMVTVYVNTPNVRVVSALGQVVRAQV 689

  Fly   657 SPVWSWHHDTLTKTIHPQGSTTKYRIIFKARVPPMGLATYVL--------------------TIS 701
            |.||.   |.      ...:...:::.|.|...|:||:.|.|                    .:|
Zfish   690 SAVWK---DA------SHATADVFQLSFVAHAAPLGLSVYQLIEVMEPRTDASKYMFLQEGRQLS 745

  Fly   702 DSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREIS---LRVG-NGPTLAFSEQGLLKSIQ 762
            |||.||                 ..|:.:|  .|.|..|.   ||:. :|.|      |||:.:.
Zfish   746 DSKLEH-----------------FRQFYQD--DGAPVVIENPHLRLSISGAT------GLLEKMM 785

  Fly   763 LTQDSPHVPVHFKFLKYGVRSHGDRSGAYLFLPN------GPASPVELGQPVVLVTKGKLESSVS 821
            |.:|.....:..:|:.||..|..|:||||||||:      .|:.|     ||:.||||.|.|.|:
Zfish   786 LKEDESEHQMKVEFVWYGTTSSKDKSGAYLFLPDKEATIYSPSQP-----PVIRVTKGTLFSEVT 845

  Fly   822 VGLPSVVHQTI-------MRGGAPEIRNLVDIGSLDNTEIVMRLETHIDSGDIFYTDLNGLQFIK 879
            .....:.| |:       :.|.:.||.|.|||....|.||.||:.:.::|.|.|:|||||.|...
Zfish   846 TTFAHITH-TLRLYNTQGVEGQSVEICNTVDIRGETNREIAMRITSDLNSKDRFFTDLNGYQVQP 909

  Fly   880 RRRLDKLPLQANYYPIPSGMFIEDANTRLTLLTGQPLGGSSLASGELEIMQDRRLASDDERGLGQ 944
            |:.:.|||||||:||:.|.::::|::.||:|||.|.||.:||.||:||::.||||..||.|||||
Zfish   910 RKTMAKLPLQANFYPMTSMLYLQDSSARLSLLTAQSLGAASLKSGQLEVIMDRRLNQDDNRGLGQ 974

  Fly   945 GVLDNKPVLHIYRLVLEKVNNCVRPSELHPAGYLTSAAHKASQSLLDPLDKFIFA---ENEWIGA 1006
            ||||||...:.:||:|||..:........|..|.:..:|.:...|..||.....:   |...:..
Zfish   975 GVLDNKITANSFRLLLEKRISVEENEATAPYSYPSILSHMSYMYLNHPLISMAVSQHLEAPSVVP 1039

  Fly  1007 QGQFGGDHPSAREDLDVSVMRRLTKSSAKTQRVGYVLHRTNLMQCGTPEEHT--------QKLDV 1063
            ........|.....:::..::...:..|.:::...:|||.. ..||....:|        .|:|:
Zfish  1040 YSPLKASFPCDMHLVNLRAIQSKEEGGAASEQAALILHRKG-FDCGFSNRNTGLLCTSTRGKIDL 1103

  Fly  1064 CHLLPNV 1070
            ..||.::
Zfish  1104 EKLLTDL 1110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 186/346 (54%)
Alpha-mann_mid 478..554 CDD:214875 44/90 (49%)
Glyco_hydro_38C 744..1103 CDD:285047 121/353 (34%)
man2a1NP_001103497.2 PLN02701 127..1149 CDD:178304 417/1045 (40%)
GH38N_Man2A1 163..509 CDD:212131 186/346 (54%)
Alpha-mann_mid 504..590 CDD:214875 44/90 (49%)
Glyco_hydro_38C 763..1145 CDD:285047 124/362 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64032625
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1101882at2759
OrthoFinder 1 1.000 FOG0002017
OrthoInspector 1 1.000 T596649
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.