DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and MAN2B1

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:XP_005259970.1 Gene:MAN2B1 HGNCID:6826 Length:1012 Species:Homo sapiens

Alignment Length:946 Identity:249/947 (26%)
Similarity:413/947 (44%) Gaps:172/947 (18%)


  Fly   145 LKVFVVPHSHNDPGWIQTFEEYY---QHDTKH-----ILSNALRHLHDNPEMKFIWAEISYFARF 201
            |.|.::||:|:|.||::|.::|:   ::|.:|     ||.:.:..|..:|..:||:.||::|:|:
Human    63 LNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVEIAFFSRW 127

  Fly   202 YHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQ-FMN-VTPTAS 264
            :|......:..::.:|:.|:|||..|||||.|||.:|:..::.|:|.|..:|:. |.| ..|..:
Human   128 WHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVA 192

  Fly   265 WAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNKGDTA-LFTHMM 328
            |.|||||||.....:..:.||......|..|..|....|:.::|.:||.....|..|| |||.::
Human   193 WHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVL 257

  Fly   329 PFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELY 393
            | ..|:.|.....|  |.|           :..|....||: .:.|.....|..::....:...|
Human   258 P-NGYNPPRNLCWD--VLC-----------VDQPLVEDPRS-PEYNAKELVDYFLNVATAQGRYY 307

  Fly   394 RTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQAH---FNVQAQFGTLQEYFDAVHQAER 455
            |||..::.:|.||:::....|   ..|.::|...:|:|..   .:|...:.|...|...:::|..
Human   308 RTNHTVMTMGSDFQYENANMW---FKNLDKLIRLVNAQQQAKGSSVHVLYSTPACYLWELNKANL 369

  Fly   456 AGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRAAEMLSA----------WH 510
            ....:    ..|||.|||....:|:||::|||..||.:|:..::::....|.|          :.
Human   370 TWSVK----HDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGLAANVGPYG 430

  Fly   511 SWDGMARIEERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVMQQSVYRLLTK 575
            |.|. |.:.|       .:::.||||.::||::.||..||.:::......|::::..::.||.. 
Human   431 SGDS-APLNE-------AMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNALARLRG- 486

  Fly   576 PSIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHVVMHNTLPHWREQLVDFYVSSP 640
               :...|:|.. .|:.|..|.|             .......|:::|.|......:|...||..
Human   487 ---FKDHFTFCQ-QLNISICPLS-------------QTAARFQVIVYNPLGRKVNWMVRLPVSEG 534

  Fly   641 FVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKY--RIIFKARVPPMGLATY-VLTISD 702
            ...|.|.....|.:.|             .|.|...:..:  .::|.|.:|.:|.:|| |..:..
Human   535 VFVVKDPNGRTVPSDV-------------VIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPR 586

  Fly   703 SKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREISLRVGNGPTLAFSEQGLLKSIQLTQDS 767
            .||:          .:.|..:|...:...:...:..   :|....|     :.|||..|......
Human   587 WKPQ----------ARAPQPIPRRSWSPALTIENEH---IRATFDP-----DTGLLMEIMNMNQQ 633

  Fly   768 PHVPVHFKFLKYGVRSHGDR-----SGAYLFLPNGPASPVELGQPVVLVTKGKLESSVSVGLPSV 827
            ..:||...|..|.. |.||.     ||||:|.||        .|..:.|::......|...|...
Human   634 LLLPVRQTFFWYNA-SIGDNESDQASGAYIFRPN--------QQKPLPVSRWAQIHLVKTPLVQE 689

  Fly   828 VHQTIMRGGA------PEIRNL--------VDIGSLDNTEIVMRLETHIDSGDIFYTDLNGLQFI 878
            |||......:      |..|:|        :.:|.....|::.|.:|.:::...||||.||.:.:
Human   690 VHQNFSAWCSQVVRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREIL 754

  Fly   879 KRRR-------LDKL-PLQANYYPIPSGMFIEDANTRLTLLTGQPLGGSSLASGELEIMQDRRLA 935
            :|||       |::. |:..||||:.:.::|.|.|.:||:||.:..|||||..|.||:|..|||.
Human   755 ERRRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLL 819

  Fly   936 SDDERGLGQGVLDNKP---VLHIYRLVLEKVNNCVRPSELHPAGYLTSAAHK--ASQSLLDPLDK 995
            .||.||:.:.:::|..   |...:.::|:             .....:|.|:  |.|.:|.|  :
Human   820 KDDGRGVSEPLMENGSGAWVRGRHLVLLD-------------TAQAAAAGHRLLAEQEVLAP--Q 869

  Fly   996 FIFAENEW----IGA--QGQFGGDHPSAREDLDVSV 1025
            .:.|....    :||  :.||.|    .|.||..||
Human   870 VVLAPGGGAAYNLGAPPRTQFSG----LRRDLPPSV 901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 103/352 (29%)
Alpha-mann_mid 478..554 CDD:214875 25/86 (29%)
Glyco_hydro_38C 744..1103 CDD:285047 91/321 (28%)
MAN2B1XP_005259970.1 PLN02701 63..1001 CDD:178304 249/947 (26%)
GH38N_AMII_LAM_like 63..341 CDD:212121 89/296 (30%)
Alpha-mann_mid 388..466 CDD:214875 25/86 (29%)
Glyco_hydro_38C 511..1001 CDD:285047 115/451 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3970
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.