DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and MAN2A1

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_002363.2 Gene:MAN2A1 HGNCID:6824 Length:1144 Species:Homo sapiens

Alignment Length:1206 Identity:471/1207 (39%)
Similarity:667/1207 (55%) Gaps:171/1207 (14%)


  Fly     2 LRIRRRFAL----VICSGCLLVFLSLYIIL---NFAAPAATQIKQPNYEN---------IENKLH 50
            :::.|:|.:    :.|    :|..|||::|   :...|     :.|..|.         ::.|:.
Human     1 MKLSRQFTVFGSAIFC----VVIFSLYLMLDRGHLDYP-----RNPRREGSFPQGQLSMLQEKID 56

  Fly    51 ELENGLQEHGEEMRNLRARLAETSN--RDDPIRP-------------PLKVARSPRPGQCQDVVQ 100
            .||..|.|:.|.:.|:|..:...|.  .|.|...             |.:::.|.....|....|
Human    57 HLERLLAENNEIISNIRDSVINLSESVEDGPKSSQSNFSQGAGSHLLPSQLSLSVDTADCLFASQ 121

  Fly   101 D-VPNVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFE 164
            . ..|.|||||::|..:||.:.||||||||::|.|:..:::. ..|:|||||||||||||::||.
Human   122 SGSHNSDVQMLDVYSLISFDNPDGGVWKQGFDITYESNEWDT-EPLQVFVVPHSHNDPGWLKTFN 185

  Fly   165 EYYQHDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGW 229
            :|::..|::|.:|.:..|.::...||||:||||.::::..:...||..:||:::|||||.|||||
Human   186 DYFRDKTQYIFNNMVLKLKEDSRRKFIWSEISYLSKWWDIIDIQKKDAVKSLIENGQLEIVTGGW 250

  Fly   230 VMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTH 294
            ||||||..|:..::.||.||..||:..:.|.|.:.||||||||||||.|:|.::|..:|||||.|
Human   251 VMPDEATPHYFALIDQLIEGHQWLENNIGVKPRSGWAIDPFGHSPTMAYLLNRAGLSHMLIQRVH 315

  Fly   295 YSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRM--GSF 357
            |:|||..|..:.|||.|||.||....|.:..|||||||||||||||||||:||||||||:  |.|
Human   316 YAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRF 380

  Fly   358 GLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYE 422
            |  |||.|||.||...||.:|:.:|:||::||::|:||.|||.|||||||:.:.||||:|..||:
Human   381 G--CPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFRTKVLLAPLGDDFRYCEYTEWDLQFKNYQ 443

  Fly   423 RLFEHINSQAHFNVQAQFGTLQEYFDAVHQAERA----GQAEFPTLSGDFFTYADRSDNYWSGYY 483
            :||:::|||:.|.|:.|||||.::|||:.:|:..    ||:.||.|||||||||||.|:|||||:
Human   444 QLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRDKGQSMFPVLSGDFFTYADRDDHYWSGYF 508

  Fly   484 TSRPYHKRMDRVLMHYVRAAEMLSAW-----HSWDGMARIEE--------RLEQARRELSLFQHH 535
            ||||::|||||::..::||||:|..:     |.:    :|.:        .|.:|||.|.|||||
Human   509 TSRPFYKRMDRIMESHLRAAEILYYFALRQAHKY----KINKFLSSSLYTALTEARRNLGLFQHH 569

  Fly   536 DGITGTAKTHVVVDYEQRMQEALKACQMVMQQSVYRLLTKPSI----YSPDFSFSYFTLDDSRWP 596
            |.||||||..|||||..|:..:|...:.::..|.:.|:.|..:    ||||   ::..:|..:  
Human   570 DAITGTAKDWVVVDYGTRLFHSLMVLEKIIGNSAFLLILKDKLTYDSYSPD---TFLEMDLKQ-- 629

  Fly   597 GSGVEDSRTTIILGEDILPSKHV----------VMHNTLPHWREQLVDFYVSSPFVSVTDLANNP 651
                        ..:|.||.|::          |::|.|...|..||..|||||.|.|...:..|
Human   630 ------------KSQDSLPQKNIIRLSAEPRYLVVYNPLEQDRISLVSVYVSSPTVQVFSASGKP 682

  Fly   652 VEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIFKARVPPMGLATYVLTISDSKPEHTSYASNLLL 716
            ||.|||.||    || ..||    |.|.|.|.|:|.:||:||..|.:..|.|.   .|:.::.:|
Human   683 VEVQVSAVW----DT-ANTI----SETAYEISFRAHIPPLGLKVYKILESASS---NSHLADYVL 735

  Fly   717 RKNPTSLPLGQYPED-----VKFGDPREISLRVGNG-PTLAFSEQGLLKSIQLTQDSPHVPVHFK 775
            .||..        ||     :|.....|..:.:.|. ..|.|.:.||:|.:...:|..|..|:.:
Human   736 YKNKV--------EDSGIFTIKNMINTEEGITLENSFVLLRFDQTGLMKQMMTKEDGKHHEVNVQ 792

  Fly   776 FLKYGVRSHGDRSGAYLFLPNGPASP-VELGQPVVLVTKGKLESSVSVGLPSVVHQTIM------ 833
            |..||.....|:||||||||:|.|.| |....|.|.||.|::.|.|:.....|.|:..:      
Human   793 FSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTCFFDHVTHRVRLYHIQGI 857

  Fly   834 RGGAPEIRNLVDIGSLDNTEIVMRLETHIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSG 898
            .|.:.|:.|:|||..:.|.||.|::.:.|.|.:.|||||||.|...|..|.|||||||.||:.:.
Human   858 EGQSVEVSNIVDIRKVYNREIAMKISSDIKSQNRFYTDLNGYQIQPRMTLSKLPLQANVYPMTTM 922

  Fly   899 MFIEDANTRLTLLTGQPLGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVLEKV 963
            .:|:||..|||||:.|.||.|||.||::|::.||||..||.|||.||:.|||...:::|::|||.
Human   923 AYIQDAKHRLTLLSAQSLGVSSLNSGQIEVIMDRRLMQDDNRGLEQGIQDNKITANLFRILLEKR 987

  Fly   964 NNCVRPSELHPAGYLTSAAHKASQSLLDPL----DKFIFAENEWIGAQGQFGGDHPSAREDLDVS 1024
            :......|.....|.:..:|..|..:..|:    :||   .:..:..||:|.....|...|:.:.
Human   988 SAVNTEEEKKSVSYPSLLSHITSSLMNHPVIPMANKF---SSPTLELQGEFSPLQSSLPCDIHLV 1049

  Fly  1025 VMRRLTK--SSAKTQRVGYVLHR-----------TNLMQCGTPEEHTQKLDVCHLLPNVARCERT 1076
            .:|.:..  .:..:.....:|||           |.|. |.|    ||...:...|.|....|..
Human  1050 NLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLF-CST----TQGKILVQKLLNKFIVESL 1109

  Fly  1077 TLTFL---------QNLEHLDGMVAPEVCPMETAAY 1103
            |.:.|         ||:..::      :.|||.:.:
Human  1110 TPSSLSLMHSPPGTQNISEIN------LSPMEISTF 1139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 196/345 (57%)
Alpha-mann_mid 478..554 CDD:214875 44/89 (49%)
Glyco_hydro_38C 744..1103 CDD:285047 132/393 (34%)
MAN2A1NP_002363.2 PLN02701 128..1144 CDD:178304 444/1071 (41%)
GH38N_Man2A1 165..508 CDD:212131 196/345 (57%)
Alpha-mann_mid 503..588 CDD:214875 44/89 (49%)
Glyco_hydro_38C 754..1139 CDD:285047 133/399 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64028694
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 758 1.000 Inparanoid score I545
Isobase 1 0.950 0 Normalized mean entropy S4542
OMA 1 1.010
OrthoDB 1 1.010 D1101882at2759
OrthoFinder 1 1.000 FOG0002017
OrthoInspector 1 1.000 T609085
orthoMCL 1 0.900 OOG5_130088
Panther 1 1.100 LDO PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3970
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.