DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and MAN2C1

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_001243423.1 Gene:MAN2C1 HGNCID:6827 Length:1057 Species:Homo sapiens

Alignment Length:946 Identity:173/947 (18%)
Similarity:293/947 (31%) Gaps:331/947 (35%)


  Fly   152 HSHNDPGWIQTFEEYYQHDTKHILSNALRHLHDNPEMKFIWA-----EISYFARFYHDLGENKKL 211
            |.|.|..|:..|:|..:...:..:: ||:.:..|||  ||:|     ::.:....|..|..    
Human   258 HCHIDTAWLWPFKETVRKCARSWVT-ALQLMERNPE--FIFACSQAQQLEWVKSRYPGLYS---- 315

  Fly   212 QMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTM 276
            :::.....||...|.|.||..|........::.|..:||.:..|......:..|..|.||:|..:
Human   316 RIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEFGKMCSEFWLPDTFGYSAQL 380

  Fly   277 PYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGP 341
            |.|:...|.:..|.|:..:::.......       ...|:....:.:..|..|..||        
Human   381 PQIMHGCGIRRFLTQKLSWNLVNSFPHH-------TFFWEGLDGSRVLVHFPPGDSY-------- 430

  Fly   342 DPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDF 406
                            |:....:...:|:::.....|::              .:..|...||..
Human   431 ----------------GMQGSVEEVLKTVANNRDKGRAN--------------HSAFLFGFGDGG 465

  Fly   407 RFKQNTEWDVQRVNYERLFEHINSQAHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTY 471
            .....|..|    ..:||     |......:.|..:.::.|.|:    .:...:..|..|:.|. 
Human   466 GGPTQTMLD----RLKRL-----SNTDGLPRVQLSSPRQLFSAL----ESDSEQLCTWVGELFL- 516

  Fly   472 ADRSDNYWSGYYTSRPYHKRMDRVLMHYVRAAEMLSAWHSWDGMARIEE------RLEQARRELS 530
                 ...:|.||:....|:.:|.....:...|:||:.    .:||..:      :|:...|.|.
Human   517 -----ELHNGTYTTHAQIKKGNRECERILHDVELLSSL----ALARSAQFLYPAAQLQHLWRLLL 572

  Fly   531 LFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVMQQSVYRLLTKPSIYSPDFSFSYFTLDDSRW 595
            |.|.||.:||:                  ..|||.::::..                  .:|.|.
Human   573 LNQFHDVVTGS------------------CIQMVAEEAMCH------------------YEDIRS 601

  Fly   596 PGSGVEDSRTTIILGEDILPSKHVVMHNTLPHWREQLVDF------------------------Y 636
            .|:.:..:....:...:..|...::: ||||..|.:::..                        .
Human   602 HGNTLLSAAAAALCAGEPGPEGLLIV-NTLPWKRIEVMALPKPGGAHSLGLTPSPGDSAQHGLCS 665

  Fly   637 VSSPFVSVTDLANNP---VEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIFKARVPPMG-LATYV 697
            .|||.::....|  |   |.:..:|..|......|||   .||.|....|.:.::.|.| |.:.|
Human   666 CSSPHLTAAPAA--PAACVRSARAPTDSASRPPPTKT---DGSVTLDNGIIRVKLDPTGRLTSLV 725

  Fly   698 LTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREISLR---VGNGPTLAFSEQGLLK 759
            |..|..:........|..:..:  .:||.....||.   ...:..|   :|...|||...:|.|:
Human   726 LVASGREAIAEGAVGNQFVLFD--DVPLYWDAWDVM---DYHLETRKPVLGQAGTLAVGTEGGLR 785

  Fly   760 SIQ--LTQDSP-------------------HVPVHF----KFL---------------------- 777
            ...  |.|.||                   |..||:    |||                      
Human   786 GSAWFLLQISPNSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHL 850

  Fly   778 --------------------------------------KYGVRSHGD-RSGAYLFLPNGPASPVE 803
                                                  |||....|. .|.:.|..|..|.:..:
Human   851 QRPTHYNTSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLLRAPKAPDATAD 915

  Fly   804 LGQP----VVLVTKGKLE-----------------------------SSVSVGLPSVVHQTIMRG 835
            .|:.    .::..||..:                             |:.||..|:||.:|:.:.
Human   916 TGRHEFTYALMPHKGSFQDAGVIQAAYSLNFPLLALPAPSPAPATSWSAFSVSSPAVVLETVKQA 980

  Fly   836 -GAPEIRNLVDIGSLDNTEIVMRL----ETHIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYY-- 893
             .:|:.|:|           |:||    .:|:|.    :..|:            ||:|....  
Human   981 ESSPQRRSL-----------VLRLYEAHGSHVDC----WLHLS------------LPVQEAILCD 1018

  Fly   894 ----PIPSG-MFIEDANTRLT---------LLTGQP 915
                |.|:| :.:.|...:||         ||..||
Human  1019 LLERPDPAGHLTLRDNRLKLTFSPFQVLSLLLVLQP 1054

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 60/336 (18%)
Alpha-mann_mid 478..554 CDD:214875 19/82 (23%)
Glyco_hydro_38C 744..1103 CDD:285047 56/313 (18%)
MAN2C1NP_001243423.1 AMS1 68..1026 CDD:223460 165/917 (18%)
GH38N_AMII_Man2C1 252..503 CDD:212124 56/310 (18%)
Alpha-mann_mid 517..596 CDD:286360 22/119 (18%)
Glyco_hydro_38C 700..1043 CDD:285047 69/378 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3970
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.