DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and MAN2A2

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_001307906.1 Gene:MAN2A2 HGNCID:6825 Length:1175 Species:Homo sapiens

Alignment Length:1224 Identity:466/1225 (38%)
Similarity:665/1225 (54%) Gaps:176/1225 (14%)


  Fly     2 LRIRRRFALVICSG---CLLVFLSLYIILNFAAPAATQIKQPNYEN-----------IENKLHEL 52
            ::::::  :.:|..   |:.|| |||::|:     ..|.....::|           ::|::.:|
Human     1 MKLKKQ--VTVCGAAIFCVAVF-SLYLMLD-----RVQHDPTRHQNGGNFPRSQISVLQNRIEQL 57

  Fly    53 ENGLQEHGEEMRNLRARLAE-TSNRDDP-------------IRPPLKVARSPRPGQCQDVVQDV- 102
            |..|:|:.|.:.:::..:.| |:|.:.|             :.||     .|||.......||. 
Human    58 EQLLEENHEIISHIKDSVLELTANAEGPPAMLPYYTVNGSWVVPP-----EPRPSFFSISPQDCQ 117

  Fly   103 -------PNVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWI 160
                   ...::|||.:.:.:.|.::|||||:||::|.|||..::| ..|:||||||||||||||
Human   118 FALGGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDA-EDLQVFVVPHSHNDPGWI 181

  Fly   161 QTFEEYYQHDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFV 225
            :||::||...|:|||::.:..|.::|..:|:|||:|:||:::.::...|:..::.:|.|||||..
Human   182 KTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGNGQLEIA 246

  Fly   226 TGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGFKNMLI 290
            |||||||||||||:..::.||.||..||::.:..||.:.||:||||:|.||||:|:::...:|||
Human   247 TGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYLLRRANLTSMLI 311

  Fly   291 QRTHYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMG 355
            ||.||::||..|....|||:|||.||:...|.:|.|||||||||:|||||||||:||||||||:.
Human   312 QRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLP 376

  Fly   356 SFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVN 420
            ...::||||||||.|::.|||.|:.||:||::||::|:|:||||:|||||||:.:..|||.|..|
Human   377 GGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLFRSNVLLVPLGDDFRYDKPQEWDAQFFN 441

  Fly   421 YERLFEHINSQAHFNVQAQFGTLQEYFDAVHQAERAG------QAEFPTLSGDFFTYADRSDNYW 479
            |:|||:..||:.:.:||||||||.:||||::  :|.|      ...||.||||||:||||.|:||
Human   442 YQRLFDFFNSRPNLHVQAQFGTLSDYFDALY--KRTGVEPGARPPGFPVLSGDFFSYADREDHYW 504

  Fly   480 SGYYTSRPYHKRMDRVLMHYVRAAEM---LSAWHS-WDGMA-RIE----ERLEQARRELSLFQHH 535
            :|||||||::|.:||||..::|.||:   |:|.|: ..|:| |..    ..|.:|||.|.|||||
Human   505 TGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDFTLLTEARRTLGLFQHH 569

  Fly   536 DGITGTAKTHVVVDYEQRMQEAL-KACQMVMQQSVYRLLTKPSIYSPDFSFSYFTLDDSRWPGSG 599
            |.||||||..|||||..|:..:| ...|:::..:.|.:|.....|..|....:..:||:|.....
Human   570 DAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDA 634

  Fly   600 VEDSRTTIILGEDILPSKHVVMHNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHH 664
            :.: ||.|.|  |..| :.||:.|.|...|..:|...|:||.|.|......|:..|:|..||   
Human   635 LPE-RTVIQL--DSSP-RFVVLFNPLEQERFSMVSLLVNSPRVRVLSEEGQPLAVQISAHWS--- 692

  Fly   665 DTLTKTIHPQGSTTKYRIIFKARVPPMGLATYVLTISDSKPEHTSYASNLLLRKNPTSLPLGQYP 729
             :.|:.:     ...|::....|:|.:||.  ||.:......|         |..|:|:.:..:.
Human   693 -SATEAV-----PDVYQVSVPVRLPALGLG--VLQLQLGLDGH---------RTLPSSVRIYLHG 740

  Fly   730 EDVKFGDPREISLRVGNGPTLAFSEQ------------GLLKSIQLTQDSPHVPVHFKFLKYGVR 782
            ..:.........|||.:..|..|:..            ||||||:...:.....|..:.|.||.|
Human   741 RQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTR 805

  Fly   783 SHGDRSGAYLFLPNGPASP-VELGQPVVLVTKGKLESSVSVGLPSVVHQTI-------MRGGAPE 839
            :..|:||||||||:|.|.| |....||:.||:|...|.| |.....:||.:       :.|.:.:
Human   806 TSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEV-VAYYEHIHQAVRLYNLPGVEGLSLD 869

  Fly   840 IRNLVDIGSLDNTEIVMRLETHIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSGMFIEDA 904
            |.:||||....|.|:.:.:.|.|||..||:|||||.|...||.|.|||||||:||:|...:|:||
Human   870 ISSLVDIRDYVNKELALHIHTDIDSQGIFFTDLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQDA 934

  Fly   905 NTRLTLLTGQPLGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVLEKVNNCVRP 969
            ..||||.|.|.||.|||..|:||::.||||..||.||||||:.|||...:.:||:||:......|
Human   935 QKRLTLHTAQALGVSSLKDGQLEVILDRRLMQDDNRGLGQGLKDNKRTCNRFRLLLERRTVGSEP 999

  Fly   970 -------------------------SELHPAGYLTSAAHKASQSLLDPLDKFIFAENEWIGAQGQ 1009
                                     .:.|...|.:..:|..|..|..|......|..:..|.  .
Human  1000 DFFSKLAAMFRGLIFHSSRSGNREVQDSHSTSYPSLLSHLTSMYLNAPALALPVARMQLPGP--G 1062

  Fly  1010 FGGDHPSARE---DLDVSVMRRL-----TKSSAKTQRVGYVLHRTNLMQCGTPEEHT-------- 1058
            ....||.|..   |..:..:|.|     |..||:|   ..:|||.. ..||...::.        
Human  1063 LRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAET---ALILHRKG-FDCGLEAKNLGFNCTTSQ 1123

  Fly  1059 ---------QKLDVCHLLPNVARCERTTLTFLQNLEHLDGMVAPEVCPMETAAY 1103
                     ..|||..|.|       |:||.|..|..........:.|||.|.:
Human  1124 GKVALGSLFHGLDVVFLQP-------TSLTLLYPLASPSNSTDVYLEPMEIATF 1170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 192/345 (56%)
Alpha-mann_mid 478..554 CDD:214875 46/85 (54%)
Glyco_hydro_38C 744..1103 CDD:285047 144/429 (34%)
MAN2A2NP_001307906.1 PLN02701 136..1174 CDD:178304 436/1077 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64018007
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 1 1.000 H55954
Inparanoid 1 1.050 758 1.000 Inparanoid score I545
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1101882at2759
OrthoFinder 1 1.000 FOG0002017
OrthoInspector 1 1.000 T609085
orthoMCL 1 0.900 OOG5_130088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3970
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.