DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and LManVI

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster

Alignment Length:936 Identity:250/937 (27%)
Similarity:426/937 (45%) Gaps:158/937 (17%)


  Fly   134 YDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYY-------QH-DTKHILSNALRHLHDNPEMKF 190
            |:.......:.:.:.:|||||:|.||::|.::|:       || ..::|:...:..|..:|..:|
  Fly    27 YEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRF 91

  Fly   191 IWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQ 255
            |..|.|:||:::.:..|..|..::.:|..|:|||..|.|.|.|||..::::|:.|.|.|..:|..
  Fly    92 IQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDD 156

  Fly   256 FMN--VTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNK 318
            ...  ..|...|.|||||||.....|..:.|:......|..:..|.:......:|.:| ...|:.
  Fly   157 TFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIW-DASDSL 220

  Fly   319 GDTALFTHMM-------PFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVA 376
            .:..:||.::       |.|.:|: | ||.||.:    |.|..                 |.||.
  Fly   221 SNDEIFTGLLYRHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVK 262

  Fly   377 ARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQ----AHFNVQ 437
            :|.|..:......|:.||:|.::||:||||:::   :..|...|.::|.:::|.:    :.||: 
  Fly   263 SRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYE---DAQVNFKNMDKLIKYVNERQAEGSTFNL- 323

  Fly   438 AQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRA 502
             .:.|...|.:::|:    |...:|..:.|||.|....::||:||:||||..||.:|...|.::.
  Fly   324 -FYSTPACYLNSLHE----GLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQV 383

  Fly   503 AEMLSAWHSWDGMARIEERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVMQQ 567
            |:.||.:...:...: :|.||..|..:.:.||||.||||.|.||..||::.:.:|:.......:.
  Fly   384 AKQLSVFAELNTKQQ-KEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARD 447

  Fly   568 SVYRLLTKP-----SIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHVVMHNTLPH 627
            .:.:|...|     |....:.|...||.||:                 ::::    |.::|.|.|
  Fly   448 GLRKLTNLPNGEFESCLQLNISECAFTKDDA-----------------DNVV----VTLYNPLAH 491

  Fly   628 WREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIFKARVPPMG 692
            ...|.|...|.:....|||.....|.::|.|| :|.    ...:..:.:.|::.::|||.|..  
  Fly   492 TSTQYVRVPVKNENYEVTDEKGRVVASEVVPV-AWQ----VLALEFRNNDTQHELVFKASVDK-- 549

  Fly   693 LATY------------VLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREISLRVG 745
            :|.|            |...:.||....:..:||.:.|....:...:...:....|..|..::..
  Fly   550 IANYYIKKVASQETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTS 614

  Fly   746 NGPTLAFSEQGLLKSIQLTQDSPHVPVHFKFLKYGVRSHGDRSGAYLFLPNGPASPVELGQPVVL 810
            ....:..::.||||::::...|.::.     ..|||....| ||||:|.        :..|...:
  Fly   615 QVKLVIDNKTGLLKTVEMNGVSENID-----QSYGVYRTYD-SGAYVFR--------QYHQADFI 665

  Fly   811 VTKGKLESSVSVG-LPSVVHQTIMRGGAPEIR-----NLVDI----GSLD-----NTEIVMRLET 860
            |....:|.:|..| |...|||......:..||     |||:|    |.::     ..|:|:...:
  Fly   666 VQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNS 730

  Fly   861 HIDSGDIFYTDLNGLQFIKRRR---------LDKLPLQANYYPIPSGMFIEDANTRLTLLTGQPL 916
            .|.|..:.|||.||.:.|||.:         ||:.|..|||||:.|.:.::|:..|:.:|..:..
  Fly   731 TIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQ 795

  Fly   917 GGSSLASGELEIMQDRRLASDDERGLGQGVLDNK---PVL---HIYRLVLEKVNNCVRPSELHPA 975
            ||:|:.:|:||:|..|||..||..|:|:.:.:.|   |::   .:|.:             |.|:
  Fly   796 GGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLI-------------LSPS 847

  Fly   976 GYLTSAAHKASQSLLDPLDKFIFAEN 1001
            ...|:|..:|.:.:..|..|| |::|
  Fly   848 DESTAAEREAEKEIHLPFWKF-FSKN 872

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 101/360 (28%)
Alpha-mann_mid 478..554 CDD:214875 32/76 (42%)
Glyco_hydro_38C 744..1103 CDD:285047 81/289 (28%)
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 85/301 (28%)
Alpha-mann_mid 359..434 CDD:286360 32/76 (42%)
Glyco_hydro_38C 482..1002 CDD:285047 111/431 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64909962
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.