DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and LManIV

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster

Alignment Length:891 Identity:237/892 (27%)
Similarity:394/892 (44%) Gaps:200/892 (22%)


  Fly   134 YDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEE-YYQHDTK-------HILSNALRHLHDNPEMKF 190
            |:.......:.:.:.:|||||||.||::|.:: ||.:..|       :||.:.:..|..:|:.:|
  Fly    27 YESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRF 91

  Fly   191 IWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQ 255
            |..|.::||::::...|:.|..:..:|..|:.||..|.|.|.||||.:::.|:.|.|.|   || 
  Fly    92 IQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVG---LK- 152

  Fly   256 FMNVT------PTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQI 314
            |:|.|      |...|.||.||||.....|....|:......|..::.|........:|.:| ..
  Fly   153 FLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIW-DA 216

  Fly   315 WDNKGDTALFTHMM-PFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQ----- 373
            .::....:||:.|: .||| |.|..|                 |.:.|         :||     
  Fly   217 SESMSGVSLFSGMLYNFYS-DTPGFC-----------------FDILC---------TDQPIIDG 254

  Fly   374 -----NVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNY---ERLFEHIN- 429
                 ||..|.|..:...|..:|:|.||.:::|:|.||:::.      .:|||   ::|.::|| 
  Fly   255 DSEENNVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYED------AKVNYKNMDKLIKYINE 313

  Fly   430 ---SQAHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKR 491
               |.:.:|:  .:.|...|.:::||:..:    :|..:.|||.||...:::|:|::||||..||
  Fly   314 RQASGSKYNI--FYSTPSCYLNSLHQSLES----WPNKTQDFFPYAHEKNSFWTGFFTSRPTQKR 372

  Fly   492 MDRVLMHYVRAAEMLSAWHSWDGMARI--EER---LEQARRELSLFQHHDGITGTAKTHVVVDYE 551
            .:|...|.::.|:.||.      :|.:  ||.   |:..|:.:.:.||||.||||.|..|..||:
  Fly   373 FERDGNHMLQVAKQLSV------LANLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYD 431

  Fly   552 QRMQEALKACQMVMQQSVYRLLTK------PSIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILG 610
            :.|.||:.......:.:: ||||.      .|....:.|...||.|.:                 
  Fly   432 RMMYEAIVGASNNARDAL-RLLTNMPYGEFESCLRLNISECAFTKDGA----------------- 478

  Fly   611 EDILPSKHVVMHNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQG 675
            :::|    |.::|.|.|...|.|...|......|||.....|.::|.|| .|.    ...:..:.
  Fly   479 DNVL----VTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSEVVPV-PWQ----VLALEYRS 534

  Fly   676 STTKYRIIFKARVPPMGLATY-VLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPRE 739
            :.|::.::|||.|..  :::| :..:..|:.:|:|                      :|..:|||
  Fly   535 NDTQHELVFKATVNK--VSSYSIKKVESSEVKHSS----------------------IKKINPRE 575

  Fly   740 ISLRVGNGPTLA---------FSEQGLLKSIQLTQDSPHVPVHFKFLKYGV-RSHGDRSGAYLFL 794
            .:    |..|:.         .:..|.|||:::...|..:..:|     || :||  .|.||.|.
  Fly   576 DN----NSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNF-----GVYKSH--TSCAYTFR 629

  Fly   795 PNGPASPVELGQPVVLVTKGKLESSVSVG-LPSVVHQTIMRGGAPEIRNLVDIGSLD-------- 850
            .:|   .:||       .:...|.:|..| |...|||.:....:..||....:..::        
  Fly   630 QDG---DIEL-------FENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPI 684

  Fly   851 ------NTEIVMRLETHIDSGDIFYTDLNGLQFIKRRR---------LDKLPLQANYYPIPSGMF 900
                  .:|.|...::.|.|..:||||.||.:.:||.:         |.:.|:..|:||:.|.:.
  Fly   685 PIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIA 749

  Fly   901 IEDANTRLTLLTGQPLGGSSLASGELEIMQDRRLASDDERGLGQGV 946
            ::|...||.||..:..||:||..|.||::..||...:|..|:|:.:
  Fly   750 LQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEAL 795

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 104/371 (28%)
Alpha-mann_mid 478..554 CDD:214875 30/81 (37%)
Glyco_hydro_38C 744..1103 CDD:285047 63/238 (26%)
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 89/311 (29%)
Alpha-mann_mid 359..434 CDD:214875 30/81 (37%)
Glyco_hydro_38C 483..973 CDD:285047 91/364 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64904846
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.