DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and LManIII

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster

Alignment Length:923 Identity:232/924 (25%)
Similarity:406/924 (44%) Gaps:173/924 (19%)


  Fly   134 YDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYY---QHDTKH-----ILSNALRHLHDNPEMKF 190
            |:.......:.:.:.:|||||:|.||::|.::||   :|:.:|     |....:..|..:...:|
  Fly    26 YESCPETKSNMINIHLVPHSHDDLGWLKTVDQYYYGNKHNIQHAGVQYIFDTVVAELSKDSRRRF 90

  Fly   191 IWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQ 255
            |..|..:||:::.|..|.||..:|::|..|:|||..|.|.|.|||..::::|:.|...|..:|..
  Fly    91 IQVETGFFAKWWEDQSETKKKLVKTLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFAVGLKFLND 155

  Fly   256 FMNV--TPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNK 318
            ...|  .|...|.||.||||.....:..:..|......|...:.|.:......||.:| ...:..
  Fly   156 NFGVCGRPRVGWQIDAFGHSREQASMFAQMAFDGQFFARMDQNDKNKRVDNLGLEMVW-DASETL 219

  Fly   319 GDTALFTHMM-------PFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVA 376
            .:...||.|:       |.:.:|  ..|..||.:    |.|..                 |.||.
  Fly   220 EEMDFFTGMLYNHYSAPPGFCFD--SLCQDDPII----DGKSY-----------------DNNVK 261

  Fly   377 ARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHIN----SQAHFNVQ 437
            :|.|..::.....|..||:|.:::|:||||:: :|...:.:  |.::|.:::|    |.:.:|: 
  Fly   262 SRVDDFLNYASNLAGYYRSNHIMVPMGDDFQY-ENAYMNYK--NMDKLIKYVNERQASGSKYNI- 322

  Fly   438 AQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRA 502
             .:.|...|.:::|::.::    ||..:.||..::..:.::|:|::||||..||.:|...|.::.
  Fly   323 -FYSTAGCYLNSLHKSLQS----FPNKTQDFLPHSHEAKSFWTGFFTSRPTQKRFERDGNHILQV 382

  Fly   503 AEMLSAWHSWDGMARIEER---LEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMV 564
            |:.||......|    ||:   |:..|:.:::.||||.||||.|..|..||::.:.:|:......
  Fly   383 AKQLSVLADLSG----EEQHKDLDYLRQIMAVMQHHDAITGTEKQEVSNDYDRLLYDAILGGANT 443

  Fly   565 MQQSVYRLLTKP-----SIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHVVMHNT 624
            .:.::..|..:|     |....:.|...||.:::                 :|.:    |.::|.
  Fly   444 ARDALRVLTNQPNGEFQSCLKLNISECAFTKENA-----------------DDFM----VTLYNP 487

  Fly   625 LPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIFKARVP 689
            |.|...|.|...|......|||.....|.:::.|| .|.    ..::..:.:.|::.::|||.|.
  Fly   488 LAHTSTQYVRVPVKEDSYQVTDEKGGLVASELVPV-PWE----VLSLEFRNNDTQHELVFKASVN 547

  Fly   690 PMGLATYVLTISDSKPE-----HTSYASNLLLRKNPTSLP-----LGQYPEDVKFGDPRE----- 739
            .  :|||.:...|...|     :|....::...::...:|     :.....|::..|.:|     
  Fly   548 K--IATYFIKKIDKTTEVDITVNTQTEQSVNEEESNVKVPKRFKKVHSLKTDLETLDDQETIVQN 610

  Fly   740 --ISLRVGNGPTLAFSEQGLLKSIQLTQDSPHVPVHFKFLKYGVRSHGDRSGAYLFLPNGPASPV 802
              |.|.:.|       ..|.||::::...|..:...|...|..      ||..|:|..:.....|
  Fly   611 SLIKLVIDN-------NTGRLKTVEMNGVSEDIDQTFGMYKTA------RSCHYIFRQDADLELV 662

  Fly   803 ELGQPVVLVTKGKLESSVSVGLPSV--VHQTIMRGGAPEIR-----NLVD----IGSLD-----N 851
            |          ...:.:|..| .||  |||.:....:..||     |.|:    :|.:.     .
  Fly   663 E----------DAFDFTVYDG-ESVKEVHQHVNEWISQVIRIYEGVNRVEFEWLVGPVPIDDELG 716

  Fly   852 TEIVMRLETHIDSGDIFYTDLNGLQFIKRRR---------LDKLPLQANYYPIPSGMFIEDANTR 907
            .|||...::.|.||.:||||.||.:.::|.:         |.:.|:..||||:.|.|.::|::.|
  Fly   717 KEIVTIFKSGISSGGVFYTDSNGREMMRREKDKREDFSPDLSEQPVSGNYYPVTSRMALQDSSKR 781

  Fly   908 LTLLTGQPLGGSSLASGELEIMQDRR-LASD--------DERGLGQGVLDNKPVLHIYRLVLE-- 961
            :.||..:..||:||..|.||:|..|| :.:|        :|:..|:|:: .:..|.:|...:|  
  Fly   782 MVLLNDRSQGGASLEDGRLEMMLHRRHIFADGSGAAEAINEQQFGKGLI-ARGKLFLYLNAIEDG 845

  Fly   962 -KVNNCVRPSELH 973
             ..:..|...|:|
  Fly   846 ATASERVAEKEIH 858

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 94/360 (26%)
Alpha-mann_mid 478..554 CDD:214875 30/79 (38%)
Glyco_hydro_38C 744..1103 CDD:285047 70/268 (26%)
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 82/301 (27%)
Alpha-mann_mid 358..433 CDD:286360 30/79 (38%)
Glyco_hydro_38C 603..998 CDD:285047 73/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64897700
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.