DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and aman-1

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_508811.1 Gene:aman-1 WormBaseID:WBGene00018877 Length:955 Species:Caenorhabditis elegans

Alignment Length:955 Identity:262/956 (27%)
Similarity:396/956 (41%) Gaps:232/956 (24%)


  Fly   130 WN----IKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYY--------QHDTKHILSNALRHL 182
            ||    :..||....||      ::||:|:|.|||:|.::|:        ....::|.:..:..|
 Worm    23 WNTCHKVDQDPNVITAH------LIPHTHDDLGWIKTVDQYFWGAKPELVPVGVQYIYNTVIDEL 81

  Fly   183 HDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLT 247
            ..||:.:|.:||..:..|:|....:..:.|::.:|||||:|.:.||||..|||.||:.:::.|:|
 Worm    82 LKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQNDEATSHYVDIIDQMT 146

  Fly   248 EGQTWLKQFMNV--TPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFL 310
            .|...|:|....  .|...|.|||||||..|..|.::.|:.::...|.||..|:...:.:.|||:
 Worm   147 LGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIHYLEKQIRLKNKTLEFM 211

  Fly   311 WR---QIWDNKGDTALFTHMMPFYSYDIPH------TCGPDPKVCCQFDFKRMGSFGLSCPWKVP 366
            |.   .|.|||    |||......:|..|.      .||.||                    .:.
 Worm   212 WNTSDDITDNK----LFTGAFFNDNYGPPEGFCWDSLCGDDP--------------------IMD 252

  Fly   367 PRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQ 431
            ...|...||..:.|..||..|.:|....||.:::.:|.||::.....|   .||.::|.:::|:.
 Worm   253 NLNIEGYNVKEKVDAFVDHVKNQAAHQSTNQVMLLMGSDFQYTNANSW---YVNLDKLIKYVNAD 314

  Fly   432 AHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLS---GDFFTYADRSDNYWSGYYTSRPYHKRMD 493
            ....|:..:.|...|..||       ||:.||||   .|||.||....:||:||:||||..|.|.
 Worm   315 TSKKVRVIYSTPACYTKAV-------QAKTPTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGMI 372

  Fly   494 RVLMHYVRAAEMLSAWHSWDGMARI----EERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRM 554
            |      :|:.||......|.:|.:    :..:|..|...:|.||||.:|||||.:|..|||:::
 Worm   373 R------QASCMLQLAKQLDVIANLGPEDDSDIEILREASALVQHHDAVTGTAKENVTRDYEKQL 431

  Fly   555 QEALKACQMVMQQSVYRL------------------LTKPSIYSPDFSFSYFTLDDSRWPGS-GV 600
            .:.:...::|:...:.::                  :.||...|.:||...|..:...:.|: .:
 Worm   432 AKGVSEVEVVINDFMKKMNPDGLDPKLVLCPLINETICKPINGSSEFSVVIFNSNGRYFNGTIRI 496

  Fly   601 EDSRTTIILGEDILPSKHVVMHNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHD 665
            ..|:.|.:|                                   .|...|.:|:|:  |.::..|
 Worm   497 PYSQKTAVL-----------------------------------RDAHKNVLESQI--VETFQID 524

  Fly   666 TLTKTIHPQGSTTKYRIIFKARVPPMGLATYVLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPE 730
            .|..|     ....|.|....||||:|..| |.....||||...:.:    ||            
 Worm   525 QLKDT-----DRLPYEIHVFVRVPPLGYTT-VFVEKGSKPERVHFNN----RK------------ 567

  Fly   731 DVKFGDPREISLRVGNGPTLA-FSEQGLLKSIQLTQDSPHVPVHFKFLKY-GVRSHGDR-SGAYL 792
              ||....||.    |...:| |..||.|..|..........:..:|..| |:.|..|: ||||:
 Worm   568 --KFNTNVEIQ----NEYLIAGFDSQGYLSYITEKATKKKRSIRQEFFYYEGIDSKDDQPSGAYI 626

  Fly   793 FLPNGPASPVELGQPVVLVTK-------GKLESSVSVGLPSVVHQTIMRGGAPEIRNLVD----I 846
            |.|       :..||:.|.:|       |.:.:.|...:...|.|.|.   .|..:|.::    :
 Worm   627 FRP-------KTQQPIALTSKLALEVVPGAIINEVRQKVSPFVSQQIR---LPRGKNYIEFEWIV 681

  Fly   847 GSLD-------NTEIVMRLETHIDSGDIFYTDLNGLQFIKR--------RRLDKLPLQANYYPIP 896
            |.:.       ..|.|.|..|.:.|.:..:||.||.|.::|        ...|..|:..|||||.
 Worm   682 GPIPKETKNPITKEFVTRYTTEVHSKNQSFTDSNGRQAMERFFDGATSFEYSDTEPIAGNYYPIT 746

  Fly   897 SGMFIEDANTRLTLLTGQPLGGSSLAS-GELEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVL 960
            |..:|:|.|.:.:::|.:..|  .:|| |.:|||..||...||..|: :..||            
 Worm   747 SFGYIKDENAQFSVITDRAQG--MVASDGVVEIMLHRRCFYDDHFGV-EEALD------------ 796

  Fly   961 EKVNNCVRPSELHPAGYLTSAAH-------KASQSLLDPL--DKF 996
                   .|.: ..||.:....|       |||.|.|.||  |.|
 Worm   797 -------EPGK-DGAGLVAMGKHIVLFTDVKASTSQLRPLAIDNF 833

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 110/361 (30%)
Alpha-mann_mid 478..554 CDD:214875 32/80 (40%)
Glyco_hydro_38C 744..1103 CDD:285047 80/293 (27%)
aman-1NP_508811.1 GH38N_AMII_LAM_like 36..313 CDD:212121 92/310 (30%)
Alpha-mann_mid 357..431 CDD:286360 32/80 (40%)
Glyco_hydro_38C 537..944 CDD:285047 97/354 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3970
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.