DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and Man2b1

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:XP_006530810.1 Gene:Man2b1 MGIID:107286 Length:1024 Species:Mus musculus

Alignment Length:1024 Identity:267/1025 (26%)
Similarity:443/1025 (43%) Gaps:237/1025 (23%)


  Fly   145 LKVFVVPHSHNDPGWIQTFEEYY------------------QH-DTKHILSNALRHLHDNPEMKF 190
            |.|.::||:|:|.||::|.::||                  || ..::||.:.:..|.:.|..:|
Mouse    63 LNVHLLPHTHDDVGWLKTVDQYYYGMDLDFLNFMPTVLSDVQHASVQYILDSVVSSLLEKPTRRF 127

  Fly   191 IWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQ 255
            |:.|:::|:|::.......:..::::|:.|:||||.|||||.|||.:|:..::.|:|.|..:|:.
Mouse   128 IYVEMAFFSRWWKQQTSATQDAVRNLVRQGRLEFVNGGWVMNDEAATHYGAIVDQMTLGLRFLQD 192

  Fly   256 FM--NVTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNK 318
            ..  :..|..:|.|||||||.....:..:.||....:.|..|..|....::.::|.|||.....:
Mouse   193 TFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFFLGRIDYQDKLNRKKKLRMEELWRASDSLE 257

  Fly   319 GDTA-LFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKV----PPRTISDQNVAAR 378
            ...| |||.::| .:|:       .||..|               |.|    ||...:.::....
Mouse   258 PPAADLFTGVLP-NNYN-------PPKYLC---------------WDVLCTDPPVVDNPRSPEFN 299

  Fly   379 SDLLVDQWKKKAE----LYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQAHFN---V 436
            :..||:.:.|.|.    .||||..::.:|.||.::....|   ..|.::|...:|:| ..|   |
Mouse   300 AKTLVNYFLKLASSQKGFYRTNHTVMTMGSDFHYENANMW---FKNMDKLIRLVNAQ-QVNGSLV 360

  Fly   437 QAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVR 501
            ...:.|...|...:::|    ...:.....|||.|||....:|:||::|||..||.:|:..::::
Mouse   361 HVLYSTPTCYLWELNKA----NLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQ 421

  Fly   502 AAEMLSA----------WHSWDGMARIEERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQE 556
            ....|.|          :.|.|. |.::|       .:::.||||.::|||:.:||.||.:::..
Mouse   422 VCNQLEALVGPEANVGPYGSGDS-APLQE-------AMAVLQHHDAVSGTARQNVVNDYARQLAA 478

  Fly   557 ALKACQMVMQQSVYRLLTKPSIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHVVM 621
            ....|::::..::.||    |.|..:|||.. .|:.|..|.|...:             ...|.:
Mouse   479 GWGPCEVLVSNALARL----SHYKQNFSFCR-ELNISICPVSQTSE-------------RFQVTL 525

  Fly   622 HNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIFKA 686
            :|.|....:|:|...|......|.|..:..:.:.|..|.|::.:|.           ::.::|.|
Mouse   526 YNPLGRKVDQMVRLPVYEGNFIVKDPHDKNISSNVVMVPSYYSETY-----------QWELLFPA 579

  Fly   687 RVPPMGLATY-VLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREISLRVGNGPTL 750
            .||.:|.:|| |..:||...:    |.|||.|      |.......|...:.:.:.....:|   
Mouse   580 SVPALGFSTYSVAKMSDLNHQ----AHNLLSR------PRKHKSHHVLVIENKYMRATFDSG--- 631

  Fly   751 AFSEQGLLKSIQLTQDSPHVPVHFKFLKYGVRSHGDR-----SGAYLFLPNGPASPVELGQPVVL 810
                .|||..|:..:.:..:||...|..|.. |.||.     ||||:|.||       :|:|:. 
Mouse   632 ----TGLLMKIENLEQNLSLPVSQGFFWYNA-SVGDEESSQASGAYIFRPN-------VGKPIP- 683

  Fly   811 VTKGKLESSVSVGLPSVVHQT----------IMRG----------GAPEIRNLVDIGSLDNTEIV 855
            |::....|.|...|...|||.          :.:|          |...:|:  |.|.    |::
Mouse   684 VSRWAQISLVKTALVQEVHQNFSAWCSQVIRLYKGQRHLELEWTVGPIPVRD--DWGK----EVI 742

  Fly   856 MRLETHIDSGDIFYTDLNGLQFIKRR-------RLDKL-PLQANYYPIPSGMFIEDANTRLTLLT 912
            .|.:|.:.:...|:||.||.:.:|||       .|::. |:..||||:.:.::|.|...:||:||
Mouse   743 SRFDTPMKTKGQFFTDSNGREILKRRDDYRPTWTLNQTEPVAGNYYPVNTRIYITDGQMQLTVLT 807

  Fly   913 GQPLGGSSLASGELEIMQDRRLASDDERGLGQGVLD---NKPVLHIYRLVLEKVNNCVRPSELHP 974
            .:..|||||..|.||:|..|||..||:||:.:.:|:   ...|...:.::|..|::         
Mouse   808 DRSQGGSSLQDGSLELMVHRRLLVDDDRGVSEPLLETDTGDKVRGRHLVLLSSVSD--------- 863

  Fly   975 AGYLTSAAHKASQSLLDPLDKFIFAENEWIGAQG--QFGGDHPSAREDLDVSVMRRLTKSSAKTQ 1037
                .:|.|:            :.||.|.:..|.  ..||..|..            ::::.|||
Mouse   864 ----AAARHR------------LLAEQEVLAPQVVLSLGGSSPYH------------SRATPKTQ 900

  Fly  1038 RVGYVLHRTNLMQCGTPEEHTQKLDVCHLLPNVARCERTTLTFLQNLEH 1086
            ..|       |.|...|:.|         |..:||.....|  |..|||
Mouse   901 FSG-------LRQELPPQVH---------LLTLARWGPKML--LLRLEH 931

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 102/371 (27%)
Alpha-mann_mid 478..554 CDD:214875 26/86 (30%)
Glyco_hydro_38C 744..1103 CDD:285047 101/382 (26%)
Man2b1XP_006530810.1 GH38N_AMII_LAM_like 63..352 CDD:212121 87/315 (28%)
Alpha-mann_mid 398..476 CDD:214875 26/86 (30%)
Glyco_hydro_38C 521..1012 CDD:285047 130/510 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3970
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.