DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and Man2a2

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_766491.2 Gene:Man2a2 MGIID:2150656 Length:1152 Species:Mus musculus

Alignment Length:1197 Identity:459/1198 (38%)
Similarity:658/1198 (55%) Gaps:145/1198 (12%)


  Fly     2 LRIRRRFALVICSG---CLLVFLSLYIILNFAA--PAATQ----IKQPNYENIENKLHELENGLQ 57
            ::::::  :.:|..   |:.|| |||::|:...  ||..|    ..:.....::|::.:||..|:
Mouse     1 MKLKKQ--VTVCGAAIFCVAVF-SLYLMLDRVQHDPARHQNGGNFPRSQISVLQNRIEQLEQLLE 62

  Fly    58 EHGEEMRNLRARLAE-TSNRDDPIRPPL----------KVARSPRPGQCQDVVQDV--------P 103
            |:.:.:..::..:.| |:|.:.|  |.|          .|...|||.......||.        .
Mouse    63 ENHDIISRIKDSVLELTANAEGP--PALLPYHTANGSWAVLPEPRPSFFSVSPQDCQFALGGRGQ 125

  Fly   104 NVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQ 168
            ..::|||.:.:.:.|.:::||||:||::|.|.|..::. ..|:||||||||||||||:||::||.
Mouse   126 KPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWDT-EDLQVFVVPHSHNDPGWIKTFDKYYT 189

  Fly   169 HDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPD 233
            ..|:|||::.:..|.::|..:|:|||:|:||:::.::...|:..::.:|.|||||..||||||||
Mouse   190 EQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGNGQLEIATGGWVMPD 254

  Fly   234 EANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVK 298
            |||||:..::.||.||..||::.:..||.:.||:||||||.||||:|:::...:|||||.||::|
Mouse   255 EANSHYFALVDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIK 319

  Fly   299 KELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPW 363
            |..|....|||:|||:||:...|.:|.|||||||||:|||||||||:||||||||:....::|||
Mouse   320 KHFAATHSLEFMWRQMWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPW 384

  Fly   364 KVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHI 428
            |||||.|::.|||.|:.||:||::||:.|:|:||||:|||||||:.:..|||.|..||:|||:.:
Mouse   385 KVPPRAITEANVADRAALLLDQYRKKSRLFRSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFL 449

  Fly   429 NSQAHFNVQAQFGTLQEYFDAVHQAERAG------QAEFPTLSGDFFTYADRSDNYWSGYYTSRP 487
            ||:..|:||||||||.|||||::  :|.|      ...||.||||||:||||.|:||:|||||||
Mouse   450 NSKPEFHVQAQFGTLSEYFDALY--KRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRP 512

  Fly   488 YHKRMDRVLMHYVRAAEMLSAWHSWDGMARIEER---------------LEQARRELSLFQHHDG 537
            ::|.:||||..::|.||:|.:      :|....|               |.:|||.|.||||||.
Mouse   513 FYKSLDRVLEAHLRGAEILYS------LALAHARRSGLAGQYPLSDFALLTEARRTLGLFQHHDA 571

  Fly   538 ITGTAKTHVVVDYEQRMQEALKAC-QMVMQQSVYRLLTKPSIYSPDFSFSYFTLDDSRWPGSGVE 601
            ||||||..|||||..|:..:|.:. |:::..:.|.:|.....||.|....:..:||||.....:.
Mouse   572 ITGTAKEAVVVDYGVRLLRSLVSLKQVIINAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHDALP 636

  Fly   602 DSRTTIILGEDILPSKHVVMHNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDT 666
            : ||.|.|  |..| :.||:.|.|...|..:|...|:||.|.|......|:..|:|..||...|.
Mouse   637 E-RTVIRL--DSSP-RFVVVFNPLEQERLSVVSLLVNSPRVRVLSEEGQPLSVQISVHWSSATDM 697

  Fly   667 LTKTIHPQGSTTKYRIIFKARVPPMGLATYVLTISDSKPEHTSYASNLLLRKNPTSLPLGQ---Y 728
            :...         |::....|:|.:||.  ||.:........:..|::.:..|...|.:.:   :
Mouse   698 VPDV---------YQVSVPVRLPGLGLG--VLQLQPDLDGPYTLQSSVRVYLNGVKLSVSRQSAF 751

  Fly   729 PEDVKFGDPREISLRVGN--------GPTLAFSEQGLLKSIQLTQDSPHVPVHFKFLKYGVRSHG 785
            |  |:..|.......:.|        |.|      ||||||:...:.....:..:||.||.|:..
Mouse   752 P--VRVVDSGASDFAISNRYMQVWFSGLT------GLLKSIRRVDEEQEQQMELEFLVYGTRTSK 808

  Fly   786 DRSGAYLFLPNGPASP-VELGQPVVLVTKGKLESSVSVGLPSVVHQTIMRGGAPEIRNL------ 843
            |:||||||||:..|.| |....||:.||:|...|.|:|.... .||.|.....|.:..|      
Mouse   809 DKSGAYLFLPDSEAKPYVPKKPPVLRVTEGPFFSEVAVYYEH-FHQVIRLYNLPGVEGLSLDMSF 872

  Fly   844 -VDIGSLDNTEIVMRLETHIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSGMFIEDANTR 907
             |||....|.|:.:|:.|.|||...|:|||||.|...|:.|.|||||||:||:|...:|:|:..|
Mouse   873 QVDIRDYVNKELALRIHTDIDSQGTFFTDLNGFQIQPRQYLKKLPLQANFYPMPVMAYIQDSQRR 937

  Fly   908 LTLLTGQPLGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVLEKVNNCVRPSEL 972
            |||.|.|.||.|||.:|:||::.||||..||.||||||:.|||...:.:||:||: ...:.| |:
Mouse   938 LTLHTAQALGVSSLGNGQLEVILDRRLMQDDNRGLGQGLKDNKITCNRFRLLLER-RTTMSP-EV 1000

  Fly   973 H-----PAGYLTSAAHKASQSLLDPLDKFIFAENEWIGAQGQFGGDHPSARE---DLDVSVMRRL 1029
            |     ...|.:..:|..|..|..|......|:.:  |........||.|..   |..:..:|.|
Mouse  1001 HQEQERSTSYPSLLSHLTSMYLSTPPLVLPVAKRQ--GTSPALRSFHPLASPLPCDFHLLNLRML 1063

  Fly  1030 -TKSSAKTQRVGYVLHRTNLMQCGTPEEHT-----------------QKLDVCHLLPNVARCERT 1076
             .:.:........:|||.. ..||...::.                 ..|||..|.|       |
Mouse  1064 PAEDTLPATDSALILHRKG-FDCGLEAKNLGFNCTTSQGKLALGSLFHGLDVTFLQP-------T 1120

  Fly  1077 TLTFLQNLEHLDGMVAPEVCPMETAAY 1103
            :||.|..|..........:.|||.:.:
Mouse  1121 SLTLLYPLASPSNSTDISLEPMEISTF 1147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 195/345 (57%)
Alpha-mann_mid 478..554 CDD:214875 43/91 (47%)
Glyco_hydro_38C 744..1103 CDD:285047 137/401 (34%)
Man2a2NP_766491.2 PLN02701 140..1151 CDD:178304 428/1054 (41%)
CE4_SF 165..508 CDD:301698 195/345 (57%)
Alpha-mann_mid 503..588 CDD:214875 43/91 (47%)
Glyco_hydro_38C 752..1147 CDD:285047 140/416 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64041491
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 1 1.000 H55954
Inparanoid 1 1.050 761 1.000 Inparanoid score I538
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002017
OrthoInspector 1 1.000 T615910
orthoMCL 1 0.900 OOG5_130088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3970
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.