DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and man2b2

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_001106515.1 Gene:man2b2 XenbaseID:XB-GENE-1006292 Length:990 Species:Xenopus tropicalis

Alignment Length:1049 Identity:259/1050 (25%)
Similarity:392/1050 (37%) Gaps:271/1050 (26%)


  Fly   145 LKVFVVPHSHNDPGWIQTFEEYYQHDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDL--GE 207
            ::.||:||||.|.||:.|.:|.......::.:..:..|......:||..|..:| |.:..|  |.
 Frog    22 IQAFVIPHSHMDVGWVYTVQESMHAYAANVYTTVVEELMRGDRRRFIVVEQEFF-RLWWKLFAGN 85

  Fly   208 NKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGH 272
            .:|.|:..:::.|:||||.||.||.|||.:...:.:||||||..::.:...|.|..||.:||||.
 Frog    86 VEKQQVHQLMREGRLEFVIGGQVMHDEALTTIDDQILQLTEGHGFIYETFGVRPRFSWHVDPFGA 150

  Fly   273 SPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPH 337
            |...|.:...:||...||.|..|..|.::...::|:|:||..........:|||:|..|||..|.
 Frog   151 SAASPTLFAMAGFNGHLISRIDYDTKADMQNGKELQFIWRASPSLSDKQEIFTHVMDQYSYCTPS 215

  Fly   338 ---------------TCGPDPKVCCQFDFKRMGSF-GLSCPWKVPPRTISDQNVAARSDLLVDQW 386
                           ...|||        .:.|.: .:|.|       ::...:...::.:|...
 Frog   216 YIPFSDRSGFYWNGIAVFPDP--------PKDGMYPNMSLP-------VTADTIHPYAETMVKNI 265

  Fly   387 KKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQAHFNVQAQFGTLQEYFDAVH 451
            |::|..:|::.:|.|.|.|   ||.....||..|.:.|.::||....|.|..|:.||.:||..::
 Frog   266 KERAAWFRSSDVLWPWGCD---KQFFNASVQFNNMDLLLDYINKHTEFGVTVQYSTLGDYFKNLY 327

  Fly   452 QAE-----RAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRAAEMLSAWH- 510
            ...     |..|        ||..|:..|...|:|:||||...|.:.|.....:.|||...|.| 
 Frog   328 NRNLTWGLRGSQ--------DFLPYSSDSSQAWTGFYTSRNVLKGVARRASSLLYAAESAFAQHL 384

  Fly   511 ----------SWDGMARIEERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVM 565
                      .|     ..|:|...|..:|..|||||||||....|...|...:.:.....:.:|
 Frog   385 LKHPTGSVEKVW-----AMEQLRSLRWAVSEVQHHDGITGTESPKVRDMYIANLLQGAAGVRKLM 444

  Fly   566 QQSVYRLLTKP-----------SIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHV 619
            ...|..|.:..           ::|:|           ..|       ..||.:|         |
 Frog   445 AAIVMDLYSSQANSCGNGYINITVYNP-----------LAW-------DVTTFVL---------V 482

  Fly   620 VMHNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIF 684
            .|:|::.                .|.|....||.||:                 |.:|       
 Frog   483 PMNNSVS----------------GVYDKFGQPVPAQI-----------------QNAT------- 507

  Fly   685 KARVPPMGLATYVLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREISLRVGNGPT 749
                                  ..|.|.:|.:......|..|:|  .:|.|.....:.|:..|..
 Frog   508 ----------------------EPSNAFDLHILVTLKGLSYGRY--SIKLGSCDAANDRLVTGRK 548

  Fly   750 LAFSEQ----------------------------GLLKSIQLTQDSPHVPVHFKFLKY---GVRS 783
            :.|..|                            .||.||...:.:..|.|..:||:|   |..|
 Frog   549 ITFVRQPKRNKAKRQNLVTPIMNDCYTVVIDQNTNLLHSITARESNQTVQVTQEFLEYHSNGDIS 613

  Fly   784 HGDRSGAYLFLPNGPASPVELGQPVVL-VTKGKLESSV-SVGLPSVVHQTIMRGGAPEIRNLVD- 845
            .|..|..|||...|||  :...:.|.| :..|||.:.: .....::..||.:......|.|:.: 
 Frog   614 KGPISDNYLFTSTGPA--ISAYKAVGLEIIAGKLVTEIRQYFYSNITAQTYLYAVYSRIYNVPEG 676

  Fly   846 ---------------IGSLD-NTEIVMRLETHIDSGDIFYTDLNGLQFIKR--RRLDKLPLQANY 892
                           :|.:| |.|.::|..|.:.:..:.|||.||.|..:|  :..|...:..||
 Frog   677 YDKSLVCHHIEQSYRVGPMDLNRESIIRTSTDLRTDRLIYTDNNGYQMQRRQFKNYDTNTVARNY 741

  Fly   893 YPIPSGMFIEDANTRLTLLTGQPLGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKPVLHIYR 957
            ||:....:|||.:|||..|:.:..|.||..:||:|||..|||.::.|..|.            |.
 Frog   742 YPMVRTAYIEDNSTRLVFLSERAHGVSSQDNGEVEIMLHRRLWNNLEWDLN------------YN 794

  Fly   958 LVLEKVNNCVRPSELHPAGYLTSAAHKASQSLLDPLDKFIFAENEWIGAQGQFGGDHPSAREDLD 1022
            |.|...      |.:.|..:|...:...:.:|...|...:               :|   |..:.
 Frog   795 LTLNDT------SVVRPTIWLMLGSRALAGALYQRLGMAL---------------EH---RPLVI 835

  Fly  1023 VSVMRRLTKSSAKTQRVGYVL-HRTNLMQCGTP--------EEHTQKLDVCHLLPNVARCERTTL 1078
            .|:.....|.|.||..:...| ...:|.....|        .||.|.:...::..|||...|..|
 Frog   836 YSLHTGQEKRSYKTTDLPITLPDNIHLQILSIPGWFYSSRHHEHMQDIHTGNIRDNVADFHRVLL 900

  Fly  1079 TFLQNLEHL 1087
                .|:||
 Frog   901 ----RLQHL 905

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 105/361 (29%)
Alpha-mann_mid 478..554 CDD:214875 29/87 (33%)
Glyco_hydro_38C 744..1103 CDD:285047 98/406 (24%)
man2b2NP_001106515.1 GH38N_AMII_Epman_like 22..346 CDD:212122 102/351 (29%)
Alpha-mann_mid 352..433 CDD:214875 29/86 (34%)
Glyco_hydro_38C 567..985 CDD:285047 95/382 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.