DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and man2a1

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:NP_001163963.1 Gene:man2a1 XenbaseID:XB-GENE-961025 Length:1150 Species:Xenopus tropicalis

Alignment Length:1166 Identity:452/1167 (39%)
Similarity:643/1167 (55%) Gaps:183/1167 (16%)


  Fly    16 CLLVFLSLYIILN---FAAPAATQIKQPNYEN---------IENKLHELENGLQEHGEEMRNLR- 67
            |:::| |||::|:   |..|     |.|..|.         :::|:..||..|.|:.|.:.|:| 
 Frog    16 CVVIF-SLYLMLDRGQFDQP-----KSPRREGALPKGQLSILQDKIDHLERLLAENNEIISNIRD 74

  Fly    68 --ARLAE-----------------TSNRDDPIRPPLKVARSPRPGQCQDV-VQDVPNVDVQMLEL 112
              ..|:|                 :|::.:|..|......:.   .||.. |......:||||::
 Frog    75 SVINLSESVKDGQKNSDSQNFSRGSSSQLEPSAPAFLPINNE---DCQFASVTGGHKSNVQMLDV 136

  Fly   113 YDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKHILSN 177
            ||.:.|.:.||||||||::|.||..::: :..|:||:||||||||||::||::|::..|:|||:|
 Frog   137 YDILPFDNPDGGVWKQGFDISYDEHEWD-NEPLQVFLVPHSHNDPGWLKTFDDYFRDQTQHILNN 200

  Fly   178 ALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNV 242
            .:..|.::...||:|:|||||::::..:...||..:|.:::..|.|.|||||||||||..|:.::
 Frog   201 MVIKLQEDKNRKFMWSEISYFSKWWDGIDNQKKEAVKRLIELEQFEIVTGGWVMPDEATPHYFSL 265

  Fly   243 LLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQL 307
            :.||.||..||::.:.|.|.:.||||||||||||.|||:.||..||||||.|||:||..|.::.|
 Frog   266 VDQLIEGHQWLEKNLGVKPKSGWAIDPFGHSPTMAYILKSSGLSNMLIQRVHYSIKKYFASKQTL 330

  Fly   308 EFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISD 372
            ||.|||.||....|.:..|||||||||:|||||||||:||||||||:....:||||:|||..|::
 Frog   331 EFFWRQNWDLGHSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVSCPWRVPPEVINE 395

  Fly   373 QNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQAHFNVQ 437
            .||..|:.:::||::||::||||.|||:|||||||:..:.|||.|..||::||.::||....:|:
 Frog   396 GNVQHRAWMILDQYRKKSKLYRTKVLLVPLGDDFRYTDSLEWDQQYENYQKLFSYMNSHPELHVK 460

  Fly   438 AQFGTLQEYFDAVHQA---ERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHY 499
            |||||:.:||.|:.:|   :......||.|||||||||||.|:|||||:||||::||::||:..:
 Frog   461 AQFGTISDYFKALRKAGNVDDPNSQSFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRLERVMESH 525

  Fly   500 VRAAEMLSAW-----HSWDGMARIE-----ERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRM 554
            :||||:|.::     :.:|.:....     :.|.:|||.|.||||||.||||||..|||||..|:
 Frog   526 LRAAEILYSFALVQMNKFDKLQSFPSVEHYKLLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRL 590

  Fly   555 QEALKACQMVMQQSVYRLLTKPS---IYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPS 616
            ..:|...:.|:..:.:.|:.|..   .|:|  |..:|::||       |:.|       :|.||.
 Frog   591 FHSLMNLKRVIIDAAHVLVLKDKDTYAYNP--SSPFFSMDD-------VQPS-------QDSLPQ 639

  Fly   617 KHVVMHNTLPHW----------REQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTI 671
            |.|:....:|.:          |..:|..||||..|.|...:...::||:|.||:.....|    
 Frog   640 KTVIKITEIPRYLTVYNPTEQERYSVVSVYVSSSKVKVISASGKALKAQISAVWNGDSAPL---- 700

  Fly   672 HPQGSTTKYRIIFKARVPPMGLATYVLTISDS----KPEHTSYASNLLLRKNPTSLPLGQYPEDV 732
                 ...|::.|.|.:|.:|||.|.|..:::    |.::|.:...  ..||..|        |.
 Frog   701 -----QDMYQVSFLAYLPALGLAVYKLVEAENSESIKADYTIFVQG--KHKNINS--------DG 750

  Fly   733 KFGDPREISLRVGNGP------TLAFSEQGLLKSIQLTQDSPHVPVHFKFLKYGVRSHGDRSGAY 791
            .| ..:|:::.||:..      .|.||..|||:.||..:|.....|...|:.||..::.|:||||
 Frog   751 NF-RIKEVNIVVGDVTIENTYLKLWFSSSGLLEKIQSKEDGKTHGVKVDFIWYGTTNNRDKSGAY 814

  Fly   792 LFLPNGPASP-VELGQPVVLVTKGKLESSVSVGLPSVVHQTI-------MRGGAPEIRNLVDIGS 848
            ||||:|.|.| :....|||.||.|.:.|.|.|....:.| |:       :.|.:|||.|:|||..
 Frog   815 LFLPDGEAKPYINADPPVVRVTHGSIFSEVVVFFKHLTH-TVRLYNVHGLEGQSPEITNVVDIRG 878

  Fly   849 LDNTEIVMRLETHIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSGMFIEDANTRLTLLTG 913
            ..|.|||||:.:.|:|...|||||||.|...||.|.|||:|||.||:.|..:|:|..:||||.:.
 Frog   879 EFNREIVMRITSDINSKHRFYTDLNGYQIQPRRTLSKLPIQANVYPMTSMAYIQDDASRLTLHSA 943

  Fly   914 QPLGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVLEKVNNCVRPSELHPAGYL 978
            |.||.:|..||:||:..||||..||.|||||||.|||...:::||:|||........:..|..|.
 Frog   944 QSLGVASSKSGQLEVFLDRRLMQDDNRGLGQGVQDNKITSNLFRLLLEKRFGKDEKEDEKPVSYP 1008

  Fly   979 TSAAHKASQSLLDPLDKFIFAENEWIGAQGQFGGDHPSAREDLDVSVMRRLTKSSAKTQRVGYVL 1043
            :..:|..|..|                       :||        .:....|..|..:..:...|
 Frog  1009 SILSHITSMFL-----------------------NHP--------VIPMAATSDSGSSVLLNAFL 1042

  Fly  1044 HRTNLMQCGTPEEHTQKLDVCHLLPNVARCERTTLTFLQNLEHLDGMVAPEVCPMETAAYV 1104
            ..|:.|.|          || |||               ||..:...|.|  .|.:.||.:
 Frog  1043 PLTSSMPC----------DV-HLL---------------NLRTIQAKVGP--IPSDEAALI 1075

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 187/342 (55%)
Alpha-mann_mid 478..554 CDD:214875 42/86 (49%)
Glyco_hydro_38C 744..1103 CDD:285047 134/373 (36%)
man2a1NP_001163963.1 PLN02701 130..1150 CDD:178304 425/1044 (41%)
CE4_SF 167..509 CDD:301698 187/342 (55%)
Alpha-mann_mid 504..590 CDD:214875 42/86 (49%)
Glyco_hydro_38C 755..1145 CDD:285047 135/382 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64035223
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1101882at2759
OrthoFinder 1 1.000 FOG0002017
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.