DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Man-IIa and man2b2

Sequence 1:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster
Sequence 2:XP_001337519.3 Gene:man2b2 ZFINID:ZDB-GENE-140106-166 Length:1006 Species:Danio rerio

Alignment Length:1052 Identity:263/1053 (25%)
Similarity:435/1053 (41%) Gaps:209/1053 (20%)


  Fly   140 NAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHD 204
            :|..|::.||:||||.|.||:.|.:|.......::.|..:..|......|||..|..:|..::.:
Zfish    18 DAAEKIQAFVIPHSHMDVGWVYTVQESMHAYASNVYSTVVEELTRVKNRKFIAVEQEFFRLWWTN 82

  Fly   205 LGEN-KKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAID 268
            :..: .|.|::.::..|:|||:.||.||.|||.:...:.:||||||..:|.:...|.|..:|.:|
Zfish    83 VASDWHKKQVRQLLLEGRLEFIIGGQVMHDEAVTDVDDAILQLTEGHGFLYETFGVRPRFAWHVD 147

  Fly   269 PFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSY 333
            |||.|.|.|.:...:||...||.|..|.:|.::.:.::|:|:||.....|....:|||.|..:||
Zfish   148 PFGASATTPVLFALAGFDAHLISRIDYDLKDDMQKNKKLQFVWRGSPTLKEKQEIFTHTMDQFSY 212

  Fly   334 DIP------HTCG---------PDPKVCCQFDFKRMGSF-GLSCPWKVPPRTISDQNVAARSDLL 382
            ..|      :..|         |||        .:.|.: .:|.|       ::.:.|...:..:
Zfish   213 CTPSYIPFSNRSGFYWNGVALFPDP--------PKDGKYPNMSLP-------VTKETVELYAQTM 262

  Fly   383 VDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQA-HFNVQAQFGTLQEY 446
            ||..:.:|:.:|::.:|.|.|.|   ||.....||..|.:.|..:||:.: .:.|..|:.||::|
Zfish   263 VDNIRLRAQWFRSSHVLWPWGCD---KQFYNASVQFSNMDVLMNYINTHSDQYGVTVQYATLKDY 324

  Fly   447 FDAVHQAE-----RAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRAAEML 506
            |..:||..     |..|        ||..|:......|:|:|.||...|.:.|.....:.|:|.|
Zfish   325 FQTLHQTNLSWDVRGNQ--------DFLPYSTEPFQAWTGFYGSRNVLKGVARRASSLLYASESL 381

  Fly   507 -SAWH-SW-DGMARIE---ERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVM 565
             :.:| |: ||..:.|   .:|:..|..:|..|||||||||....|...|.:.:.:.:...:.::
Zfish   382 FTRYHISYPDGPVQREWALSKLKALRWAVSEVQHHDGITGTESPKVADMYMEHLLQGMMGAEELL 446

  Fly   566 QQSVYRLLTKPSIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHVVMHNTLPHWRE 630
             .:::.|   |...|.|..             ..::::.||.....:.:|.:|:.::|.|.....
Zfish   447 -AAIFLL---PQTLSNDIY-------------DQIKNTPTTARTDSENVPEQHIFVYNPLAWNIS 494

  Fly   631 QLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIFKARVPPMGLAT 695
            ..|:..|......|.|.....|.||:.|              ...|:|.|.:.|...:..:....
Zfish   495 TYVNVSVQYAMAVVLDDDGKAVPAQIQP--------------SMESSTVYDLFFVVELGGLQYRK 545

  Fly   696 YVLTISDSKPEHTSYASNL-----LLRKNPTSLPLGQYPEDVKFGDPREISLRVGNGPTLAF-SE 754
            |.:....| |..|..|...     :::.|.|::...:     |.|  |::...:.....|.| .|
Zfish   546 YTVQFPQS-PCDTGSACGATHVAKVVKFNKTNVRQWK-----KTG--RKLLPVLNECYKLMFDQE 602

  Fly   755 QGLLKSIQLTQDSPHVPVHFKFLKYGVRSHGD-RSGA----YLFLPNGPASPVELGQPVVL-VTK 813
            ..||.||........|.|...|.:|  :::|| :||.    |:|..||.|.|..  :.||: :..
Zfish   603 TNLLHSITDRSKKIRVRVQQDFWEY--KANGDVQSGPISDNYIFTANGSAVPAY--KSVVMEIVP 663

  Fly   814 GKLESS---------------------VSVGLPSVVHQTIMRGGAPEIRNLVDIGSLD-NTEIVM 856
            ||:.|.                     |.||...       |.....:.....:|.|: |.|.|.
Zfish   664 GKVISEIRQYFYREEEDANHTYSVVTRVPVGFKG-------RLSCFRLEQSYKVGPLEVNRETVF 721

  Fly   857 RLETHIDSGDIFYTDLNGLQFIKR--RRLDKLPLQANYYPIPSGMFIEDANTRLTLLTGQPLGGS 919
            |..|.:.:....:||.||.|.:||  :......:..||||:....::||.::|:..|:.:..|.:
Zfish   722 RTRTSLQNNRTLFTDNNGYQMMKRTYKGYANNTVARNYYPMVRVAYMEDESSRVVFLSERAHGVA 786

  Fly   920 SLASGELEIMQDRRLASDDERGLGQGVLDN-----KPVL-----------HIYR----------- 957
            ||:.|:||:|..|||.::.|...|..:..|     :|||           .||:           
Zfish   787 SLSQGQLEVMLHRRLWNNQEWNQGYNLTLNDSSVVRPVLWMMLGSPDSLSSIYQQEAVELQHRPV 851

  Fly   958 -LVLEKVNNCVRPSE------LHPAGYLTSAAHKASQSLLDPLDKFIFAENEWIGAQGQFGGDHP 1015
             :.:::....:...|      :||. .|....|  .|||..|         .|     .:..:|.
Zfish   852 VMAIDQPQKLLNQRETFSGPSVHPV-VLPQNLH--MQSLSIP---------GW-----NYSPEHS 899

  Fly  1016 SAREDLDVSVMRRLTKSSAKTQRVGYVLHRTNLMQCGTPEEHTQKL-----DVCHLLPNVARCER 1075
            |..::          ||.....|:  :|..|:|.:.|.....:|..     :|...:..|::.:.
Zfish   900 SGGDE----------KSEVNFDRI--LLRITHLYEEGESPVLSQPTTINLKEVMQGIGKVSKVQE 952

  Fly  1076 TTLTFLQNLEHL 1087
            .:||...|:..|
Zfish   953 CSLTGTWNISDL 964

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 107/362 (30%)
Alpha-mann_mid 478..554 CDD:214875 29/82 (35%)
Glyco_hydro_38C 744..1103 CDD:285047 96/415 (23%)
man2b2XP_001337519.3 PLN02701 20..1002 CDD:178304 262/1051 (25%)
GH38-57_N_LamB_YdjC_SF 23..348 CDD:330225 104/351 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.