DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and AT3G61960

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_567122.1 Gene:AT3G61960 AraportID:AT3G61960 Length:626 Species:Arabidopsis thaliana

Alignment Length:606 Identity:149/607 (25%)
Similarity:269/607 (44%) Gaps:120/607 (20%)


  Fly     6 ITDFEILEKLGAGSYATVYKARHKKQRTYHAIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVT 70
            :.|:.:..::|:||:|.|:.|:|:......|:|.::...||...|:||:.||.:|..:.|..|:.
plant     7 VGDYALGPRIGSGSFAVVWLAKHRSSGLEVAVKEIDKKLLSPKVRDNLLKEISILSTIDHPNIIR 71

  Fly    71 LQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQ 135
            ..:.......|::|||||:.|:|:.:|.....:||:..::|:||||..:|.::.....|.|||||
plant    72 FYEAIETGDRIFLVLEYCSGGDLAGYINRHGKVPEAVAKHFMRQLALGLQVLQEKHFIHRDLKPQ 136

  Fly   136 NLLLTRGANNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSIGVILYE 200
            ||||:.......||:.|||||:.|....:.:...||||||||||:|..:|||||||||.|.||::
plant   137 NLLLSSKEVTPLLKIGDFGFARSLTPESMAETFCGSPLYMAPEIIRNQKYDAKADLWSAGAILFQ 201

  Fly   201 CLFGKAPYSSRTIEELLLRIRKAEAITLPPNAR--ISNECHDLLRRLLAHEPTARISFADFFAHP 263
            .:.||.|:......:|...|.:...:..|.:.|  |..:|.||.|.||...|..|::|.:||.|.
plant   202 LVTGKPPFDGNNHIQLFHNIVRDTELKFPEDTRNEIHPDCVDLCRSLLRRNPIERLTFREFFNHM 266

  Fly   264 FL-DLKTFP-TEH---TLQKAIDLVTQACAYDEKHNYK---EAYYLYCSALQYFVPLITEETDAT 320
            || :.:..| .||   :......|:..|......:.:|   |..:.:.|:          .:.:.
plant   267 FLREPRQIPDVEHSGFSTCTGKSLLPSAQPSTSTNRFKSSAENVHKHGSS----------SSASN 321

  Fly   321 KRLALRNRALSYTKRAEEIKNC------------IIEDEYRM----------------------- 350
            .::::.:.:...|::..| ..|            :||.||.:                       
plant   322 SQISMPHTSFEKTRKDTE-GQCSSNQSGVVDSLELIEREYVLVNRPSASLEGSSDCFDTSLQDSG 385

  Fly   351 ---LAERQRQAATAATANQEPSSATQVPAAQPSSSRVAE-----MLEPDSRYKQLYALSNSSPSM 407
               :..|..:.::::...|:|.|....|.....|..:.|     ::.|.::.:.|:..:.:...:
plant   386 FPNILPRNEKVSSSSLEAQKPLSDVSGPRPASVSYLLTEVQRLTIVHPPTKLQLLHQYAQALTEL 450

  Fly   408 KTGLEIGRKGE-----------LYLYERKLDAALESYTSALG-------------ILVPFVNNEP 448
            .:  |:|..|:           |.::.:.|:.. :|:..::|             ..:|.:|:  
plant   451 AS--EMGNTGQVKESFAVTLVVLAVWRKALEIC-DSWMMSVGENEVNPDPTTAPETSIPDLNS-- 510

  Fly   449 KGERRNLLLQQLEFWMKEAESIKSIL----SAKHLDD-----------------EEQKLSTRTSL 492
            ....:..:.|:....:.:||::.:.|    :|.|:.|                 .|:.||.:.|.
plant   511 PAPAKTWVTQEFVTALNQAENLSTQLNETSAATHMPDAMETIYERALAYGKSGGAEEYLSNKESA 575

  Fly   493 RTITFQGWSKPPLIFFILFIV 513
            .|:    :.|  .|..:.||:
plant   576 ATL----YKK--AILLLSFII 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 98/258 (38%)
PKc_like 13..264 CDD:304357 97/253 (38%)
MIT_2 274..348 CDD:239147 12/92 (13%)
MIT 407..472 CDD:282117 12/89 (13%)
AT3G61960NP_567122.1 S_TKc 10..268 CDD:214567 98/258 (38%)
STKc_ATG1_ULK_like 16..267 CDD:270911 97/251 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125075
orthoMCL 1 0.900 OOG5_127101
Panther 1 1.100 O PTHR24348
Phylome 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.