DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and AT2G37840

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_850285.1 Gene:AT2G37840 AraportID:AT2G37840 Length:733 Species:Arabidopsis thaliana

Alignment Length:555 Identity:156/556 (28%)
Similarity:263/556 (47%) Gaps:138/556 (25%)


  Fly     6 ITDFEILEKLGAGSYATVYKARHKKQRTYHAIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVT 70
            :.|:.:..::|:||::.|::|||:...|..|||.:.|..|::..:|:|::||.:||.:.|..|:.
plant     9 VGDYLVGRQIGSGSFSVVWEARHRVDGTEVAIKEIAMDRLNKKLQESLMSEIFILRRINHPNIIR 73

  Fly    71 LQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQ 135
            |.|.......:::|||||..|:||.:::....:||:|.::|::||||.:|.:|.|::.|.|||||
plant    74 LIDMIKSPGKVHLVLEYCKGGDLSVYVQRHGIVPEATAKHFMQQLAAGLQVLRDNNIIHRDLKPQ 138

  Fly   136 NLLLTRGANNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSIGVILYE 200
            ||||:...|:..||:||||||:.|:...:.:.|.||||||||||::..:|||||||||:|.||::
plant   139 NLLLSTNENDADLKIADFGFARSLQPRGLAETLCGSPLYMAPEIMQLQKYDAKADLWSVGAILFQ 203

  Fly   201 CLFGKAPYSSRTIEELLLRIRKAEAITLPPNAR-ISNECHDLLRRLLAHEPTARISFADFFAHPF 264
            .:.|:.|::..:..:||..|.::..:..|.:.| :|.:|.||.::||...|..|::|.:||.|||
plant   204 LVTGRTPFTGNSQIQLLQNIIRSTELHFPGDCRDLSLDCIDLCQKLLRRNPVERLTFEEFFNHPF 268

  Fly   265 L-DLKTFPTEHTLQKAIDLVTQ----ACAYDEKHNYKEAYYLYCSALQYFV----------PLIT 314
            | |.:::...   :..:.|.|.    :.......|.:|:....|  |.:.:          |...
plant   269 LSDRQSYDFS---RSRLGLRTMDGFLSSGSSPSRNMEESSQEDC--LPFLLDDDSSGPEGSPSYL 328

  Fly   315 EETDATK------------RLALRNRALSYTKRA-------EEIKNCIIEDEYRMLAE-----RQ 355
            ::|.:.|            |..:.:..|.:|:..       ::::|    |.:|...:     |.
plant   329 KKTSSMKSSSGIKVDTRIERKEVESSPLKHTELTSGYSSFNQKVEN----DRFRFETQINSDRRN 389

  Fly   356 RQAATAAT-----------------------------------------------ANQEP----- 368
            |:..|..|                                               .:|.|     
plant   390 RREPTGLTDSRSLIAPGRVDDSQDSMDQDFVLVSGPPVDMPSSSSSSSKPYNFPFKSQSPPVELF 454

  Fly   369 ----SSATQVPAAQPSSSRVAEMLEPDSRYKQLYALSNSSPSMKTG-LEIG-------------- 414
                ||...:|....:|:.:.:....||:|        |:||...| |::|              
plant   455 NRSISSTAPMPIIGATSNSIGQFGSLDSQY--------SAPSTSHGSLDLGDAFEQPSTHSLTRI 511

  Fly   415 ---RK-----GELYLYER-KLDAALESYTSALGIL 440
               ||     .|| :||| :.|..||:::..|.||
plant   512 RSLRKYAATIAEL-VYERIESDKHLEAFSIQLAIL 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 106/257 (41%)
PKc_like 13..264 CDD:304357 105/252 (42%)
MIT_2 274..348 CDD:239147 14/107 (13%)
MIT 407..472 CDD:282117 16/59 (27%)
AT2G37840NP_850285.1 S_TKc 12..269 CDD:214567 106/257 (41%)
STKc_ATG1_ULK_like 18..268 CDD:270911 105/250 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125075
orthoMCL 1 0.900 OOG5_127101
Panther 1 1.100 LDO PTHR24348
Phylome 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.