DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and Ulk3

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001258064.1 Gene:Ulk3 RGDID:1587417 Length:472 Species:Rattus norvegicus

Alignment Length:499 Identity:204/500 (41%)
Similarity:293/500 (59%) Gaps:48/500 (10%)


  Fly     3 LPRITDFEILEKLGAGSYATVYKARHKK-QRTYHAIKYVEMSTLSQTSRENLITEIRLLRELKHK 66
            |||:..|.:.|:||:|:|||||||..|| .|...|||.|...:|::.|.|||:|||.:|:.::|.
  Rat     8 LPRLDGFILTERLGSGTYATVYKAYAKKATREVVAIKCVAKKSLNKASVENLLTEIEILKGIRHP 72

  Fly    67 YIVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFD 131
            :||.|:||.||:.|||:::|:|..|:||.||.|::.|||...|.|::|||:|:|::...::||.|
  Rat    73 HIVQLKDFQWDNDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLD 137

  Fly   132 LKPQNLLLTRGANNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSIGV 196
            |||||:||: ......||:||||||||:...:....|:|||||||||:|.:.||||:.||||:||
  Rat   138 LKPQNILLS-SLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCRRQYDARVDLWSVGV 201

  Fly   197 ILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTARISFADFFA 261
            ||||.|||:.|::||:..||..:||....|.||...::|.:|.|||:|||..:|:.||||.||||
  Rat   202 ILYEALFGQPPFASRSFSELEEKIRSNRVIELPLRPQLSLDCRDLLQRLLERDPSHRISFQDFFA 266

  Fly   262 HPFLDLKTFPTEHTLQKAIDLVTQACAYDEKHNYKEAYYLYCSALQYFVPLITEETDATKRLALR 326
            ||::||:..|:..:|.:|..||.:|...|::.:...|..|||.||.:|||.:..|.||.::.|::
  Rat   267 HPWVDLEHMPSGESLAQATALVVEAVKKDQEGDAAAALSLYCKALDFFVPALHYEVDAQRKEAIK 331

  Fly   327 NRALSYTKRAEEIKNCIIEDEYRMLAERQRQAATAATANQEPSSATQVPAAQPSSSRVAEMLEPD 391
            .:...|..||||:|..:......:|    ||..|.                       .|:|...
  Rat   332 AKVGQYVSRAEELKAIVSSSNQALL----RQGTTG-----------------------QELLREM 369

  Fly   392 SRYKQ--LYALSNSSPSMKTGLEIGRKGELYLYERKLDAALESYTSALGILVPFVNNEPKGERRN 454
            :|.|.  |.||..:|.:|....|.|::.:          ||:.|..:||.|:..:..|..|.||.
  Rat   370 ARDKPRLLAALEVASAAMAKEEEAGKEQD----------ALDLYQHSLGELLLLLAAEAPGRRRE 424

  Fly   455 LLLQQLEFWMKEAESIK-------SILSAKHLDDEEQKLSTRTS 491
            ||..:::..|..||.:|       |...|:.||.|....|.|:|
  Rat   425 LLHTEVQNLMARAEYLKEQIKIRESHWEAESLDKEGLSESVRSS 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 134/257 (52%)
PKc_like 13..264 CDD:304357 133/252 (53%)
MIT_2 274..348 CDD:239147 25/74 (34%)
MIT 407..472 CDD:282117 19/72 (26%)
Ulk3NP_001258064.1 S_TKc 14..270 CDD:214567 134/257 (52%)
STKc_ULK3 18..269 CDD:271023 133/252 (53%)
MIT_2 279..353 CDD:239147 25/74 (34%)
MIT 374..449 CDD:294211 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C222767638
eggNOG 1 0.900 E1_KOG0595
Hieranoid 1 1.000
Homologene 1 1.000 H68482
Inparanoid 1 1.050 344 1.000 Inparanoid score I2227
OMA 1 1.010
OrthoDB 1 1.010 D1084750at2759
OrthoFinder 1 1.000 FOG0005403
OrthoInspector 1 1.000 T1087780
orthoMCL 1 0.900 OOG5_127101
Panther 1 1.100 LDO PTHR24348
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.