DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and si:ch211-63o20.7

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001038586.2 Gene:si:ch211-63o20.7 ZFINID:ZDB-GENE-041001-194 Length:357 Species:Danio rerio

Alignment Length:377 Identity:84/378 (22%)
Similarity:143/378 (38%) Gaps:125/378 (33%)


  Fly     9 FEILEKLGAGSYATVYKARHKKQRTYH------AIKYV-------------EMSTLSQTSREN-- 52
            :.:.:::|.|||..|:|.|..:...:.      |||.:             |:..:..|:|.:  
Zfish     5 YTLQQEVGRGSYRVVFKGRVTETGWWGAKGDTVAIKRLPCCSPESIELYLQELWAMRITARNHPN 69

  Fly    53 --------LITEIRLLRELKHKYI------------VTLQDFFWDDKN----------------- 80
                    |.|..|.|:.|:...:            |..:|.....:|                 
Zfish    70 VIALYNCLLQTGPRTLQPLRSSRLPLDLVESALKGRVVDKDSKTQTRNASRSKRRLISKEEVPRR 134

  Fly    81 ---IYIVLEYCNAGNLSAFIRTKKALPESTC-RYFLRQLAAAVQYMRANDVSHFDLKPQNLLLTR 141
               :::|:|||..|:|..:|.::.  |::.| ...:||:.:|:.::..:.:.|.||||.|:|:..
Zfish   135 CFALWLVMEYCEGGDLGQYILSRP--PDAECNNTVVRQICSAIAFLHEHGIVHRDLKPDNVLVCL 197

  Fly   142 GANNVSLKVADFGFAQHLKLGEINQQLK-------GSPLYMAPEIVRKHQYDAKADLWSIGVILY 199
            ......:||||||.:..|.......|.:       ||..|||||:.....|.|:||::|:||:.:
Zfish   198 TKEGPVMKVADFGLSNMLDNPTDGVQSRLALSSTCGSDFYMAPEVWAGRSYTAQADIFSLGVLFW 262

  Fly   200 ECL--------------FGKAPYSSRTIEELL--------------LRIRKAEAITLPPNARISN 236
            ..|              .|......|.:..|.              :|.|:|..:..|||..:  
Zfish   263 AVLERITFLEDGTNQEQLGAYVMRGRWLSPLAEALCENPDLQLIIPMRTRRAPPLPPPPNPSM-- 325

  Fly   237 ECHDLLRRLLAHEPTARISFADFFAHPFLDLKTFPTEHTLQKAIDLVTQACA 288
             | :||..:|..:|.||                 ||...|::.:.     ||
Zfish   326 -C-ELLLDMLDVDPDAR-----------------PTADQLEERVQ-----CA 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 79/353 (22%)
PKc_like 13..264 CDD:304357 79/348 (23%)
MIT_2 274..348 CDD:239147 3/16 (19%)
MIT 407..472 CDD:282117
si:ch211-63o20.7NP_001038586.2 PKc_like 5..350 CDD:304357 82/368 (22%)
S_TKc 5..346 CDD:214567 81/364 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.