DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and Atg1

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001163433.1 Gene:Atg1 FlyBaseID:FBgn0260945 Length:855 Species:Drosophila melanogaster

Alignment Length:508 Identity:146/509 (29%)
Similarity:236/509 (46%) Gaps:86/509 (17%)


  Fly     6 ITDFEILEK--LGAGSYATVYKARHKKQRTYHAIKYVEMSTLSQTSRENLI-TEIRLLR---ELK 64
            :.::|...|  ||.|::|.|||.||:|:....|||.:  :...|...:||: .||::|:   ||.
  Fly     4 VGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCI--TKKGQLKTQNLLGKEIKILKELTELH 66

  Fly    65 HKYIVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSH 129
            |:.:|.|.|.......:.:|:||||.|:|:.::..|..|.|.|.|.||.|||.|::.:....:.|
  Fly    67 HENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALYTKGIVH 131

  Fly   130 FDLKPQNLLLTR-------GANNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDA 187
            .||||||:||:.       ..:.::||:||||||:.|..|.:...|.|||:|||||::...|||:
  Fly   132 RDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGSPMYMAPEVIMSLQYDS 196

  Fly   188 KADLWSIGVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPN--ARISNECHDLLRRLLAHEP 250
            ||||||:|.|:|:||.||||:.::|..|  |:....:...|.|.  :.:|.:..|||..||....
  Fly   197 KADLWSLGTIVYQCLTGKAPFYAQTPNE--LKSYYEQNANLAPKIPSGVSPDLRDLLLCLLRRNS 259

  Fly   251 TARISFADFFAHPFLDLK----------------------------------------TFPTEHT 275
            ..|||:..||.|.||..|                                        ..|.:..
  Fly   260 KDRISYESFFVHRFLQGKKAAVSPGEPSQAANLRRRVSKSGVLPVDMPPLGGTPPAKAKSPLQQQ 324

  Fly   276 LQKAIDLVTQACAYDEKHNYKEAYY-----------LYCSALQYFVPLITEETDATKRLALRNRA 329
            |::.:.||..|....::...:||..           ..|:.:.....|...|.:        :.:
  Fly   325 LEQELKLVKLAEQQQKEREEQEAQEDENTVSVVANPAICATITNVGVLCDSENN--------SGS 381

  Fly   330 LSYTKRAEEI----KNCIIEDEYRMLAERQRQAATAATANQEPSSATQVPAAQPSSSRVAEMLE- 389
            .|..:.:::.    || :.||:.:.||:.|.|.|:.....|:..:.:..|  :|||..::|... 
  Fly   382 CSSHEDSDDFVLVPKN-LPEDQRQGLAQVQAQPASGGQRPQQQQNQSSPP--RPSSLPISEPKPV 443

  Fly   390 PDSRYKQLYALSNSSPSMKTGLEIGRKGELYLYERKLDAALESYTSALGILVP 442
            |....:|:......:.:...|.:|.|...:.:.:.:.|....|.:|.:..:.|
  Fly   444 PAPARRQVARPGPLTVATLGGQQIPRSQPISVKQPRPDQRKSSVSSDINSISP 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 109/271 (40%)
PKc_like 13..264 CDD:304357 107/266 (40%)
MIT_2 274..348 CDD:239147 14/89 (16%)
MIT 407..472 CDD:282117 7/37 (19%)
Atg1NP_001163433.1 S_TKc 9..274 CDD:214567 108/269 (40%)
STKc_ULK1_2-like 15..273 CDD:271022 106/262 (40%)
DUF3543 638..844 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116572319
eggNOG 1 0.900 E1_KOG0595
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127101
Panther 1 1.100 P PTHR24348
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5656
65.870

Return to query results.
Submit another query.