DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and Ulk2

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006533571.1 Gene:Ulk2 MGIID:1352758 Length:1051 Species:Mus musculus

Alignment Length:270 Identity:106/271 (39%)
Similarity:168/271 (62%) Gaps:10/271 (4%)


  Fly     6 ITDFEILEK--LGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKY 67
            :.|||..::  :|.|::|.|::.||:::..:. |||.:....||: |:..|..||::|:||:|:.
Mouse     4 VGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSK-SQILLGKEIKILKELQHEN 67

  Fly    68 IVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDL 132
            ||.|.|......::::|:||||.|:|:.:::.|..|.|.|.|.||.|:|||::.:.:..:.|.||
Mouse    68 IVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDL 132

  Fly   133 KPQNLLLT---RGANNVS---LKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADL 191
            ||||:||:   |..:|||   :|:||||||::|....:...|.|||:|||||::....|||||||
Mouse   133 KPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADL 197

  Fly   192 WSIGVILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTARISF 256
            ||||.::|:||.||.|:.:.:.::|.:...|..::........|....:||..||......|:.|
Mouse   198 WSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDF 262

  Fly   257 ADFFAHPFLD 266
            ..||:||||:
Mouse   263 EAFFSHPFLE 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 104/265 (39%)
PKc_like 13..264 CDD:304357 101/260 (39%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
Ulk2XP_006533571.1 STKc_ULK2 2..272 CDD:271103 106/269 (39%)
S_TKc 9..271 CDD:214567 102/263 (39%)
DUF3543 <865..1015 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127101
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5656
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.