DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and atg1

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_587982.1 Gene:atg1 PomBaseID:SPCC63.08c Length:830 Species:Schizosaccharomyces pombe

Alignment Length:463 Identity:144/464 (31%)
Similarity:216/464 (47%) Gaps:83/464 (18%)


  Fly     6 ITDFEILEKLGAGSYATVYKARHKKQRTYHAIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVT 70
            |..:.|..::|.||:|.|||.:|.:.....:||.|....|::...|||.:||.:|:|::|.::|.
pombe    11 IGPYVIRSEIGRGSFAIVYKGKHTETNRVISIKSVLTKKLTKKLLENLESEISILKEIRHVHVVE 75

  Fly    71 LQDFFWDDKNIYIVLEYCNAGNLSAFIRT---------------------KKALPESTCRYFLRQ 114
            |.|.....:.|::|:|||:.|:||.|||.                     |..|.|:..|:|.:|
pombe    76 LIDCIKAGRFIHLVMEYCSLGDLSYFIRKREKFNSIPSLAWINIDHPPVYKAGLNETLVRHFTQQ 140

  Fly   115 LAAAVQYMRANDVSHFDLKPQNLLLTR--------------GANNV-SLKVADFGFAQHLKLGEI 164
            ||:|:|::|:..:.|.|:|||||||..              |:..: .||:||||||::|:...:
pombe   141 LASALQFLRSRSLIHRDVKPQNLLLQPPPTAAYLEEHPQFVGSPKLPMLKLADFGFARYLQTSSM 205

  Fly   165 NQQLKGSPLYMAPEIVRKHQYDAKADLWSIGVILYECLFGKAPYSSRTIEELLLRIRKA-EAITL 228
            .:.|.||||||||||:|..:|||||||||:|.:|||...||.|:.:....|||.||:|| :.|..
pombe   206 AETLCGSPLYMAPEILRYEKYDAKADLWSVGAVLYEMAVGKPPFKAPNHVELLRRIQKAKDVIKF 270

  Fly   229 PPNARISNECHDLLRRLLAHEPTARISFADFFAH-----PFLDLKTFPTEHTLQ---KAIDLVTQ 285
            |..|.|..:...|:..||...|..||.:..||:.     |..|..|. |...:|   |.|::.:.
pombe   271 PEEAFIHPDIKTLICALLKQNPADRIDYDGFFSSIVVTTPLDDASTL-TGSDIQDAVKEINIPSS 334

  Fly   286 ACAYDEKHNYKEAYYLYCSALQYFVPLITEETDATKRLALRN--RALSYTKRAEEIKNCIIEDEY 348
            :.||                :..|.|.......|.....||.  :|...:.:..||....:...|
pombe   335 SPAY----------------ITDFFPKSNPGAPAPPGGLLRQAFQAQGSSIQPSEITGRRVPHRY 383

  Fly   349 RMLAERQRQAATAATANQEPSSATQVPAAQPSSSRVAEMLEPDSRYKQLYALSNSSPSMKTGLEI 413
            .                |:.::....|...|.|:..|.:..|....||  .:..:||:..|. :.
pombe   384 A----------------QDGNTLPYTPVFPPESAPAASIFPPRLTSKQ--PIPMASPAKLTS-DT 429

  Fly   414 GRKGELYL 421
            ..|...|:
pombe   430 SNKSSAYV 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 113/298 (38%)
PKc_like 13..264 CDD:304357 112/293 (38%)
MIT_2 274..348 CDD:239147 13/79 (16%)
MIT 407..472 CDD:282117 3/16 (19%)
atg1NP_587982.1 S_TKc 14..296 CDD:214567 109/282 (39%)
STKc_ATG1_ULK_like 20..306 CDD:270911 111/286 (39%)
DUF3543 590..806 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1125279
orthoMCL 1 0.900 OOG5_127101
Panther 1 1.100 O PTHR24348
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5656
TreeFam 1 0.960
54.990

Return to query results.
Submit another query.