DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and ulk1a

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001124103.1 Gene:ulk1a ZFINID:ZDB-GENE-080723-31 Length:927 Species:Danio rerio

Alignment Length:504 Identity:151/505 (30%)
Similarity:245/505 (49%) Gaps:75/505 (15%)


  Fly     8 DFEILEKLGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVTL 71
            :|...:.:|.|::|.|:|.|||::..:. |:|.:....|:: |:..|..||::|:||||:.||:|
Zfish     8 EFNRKDLIGHGAFAVVFKGRHKQKHNFEVAVKCINRKNLAK-SQSLLGKEIKILKELKHENIVSL 71

  Fly    72 QDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQN 136
            .||......:|:|:||||.|:|:.::.:|..|.|.|.|..|:|||.|:..:|:..:.|.||||||
Zfish    72 LDFQEISGCVYLVMEYCNGGDLAEYLHSKGCLSEDTIRVLLQQLAGAMSVLRSKGIIHRDLKPQN 136

  Fly   137 LLLT------RGANNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSIG 195
            :||:      ...||:.:|:||||||::|:...:...|.|||:|||||::..|.|||||||||:|
Zfish   137 ILLSYSTGRKSNPNNICIKLADFGFARYLQGNTMAATLCGSPMYMAPEVIMSHNYDAKADLWSVG 201

  Fly   196 VILYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTARISFADFF 260
            .|:|:||.||||:.:.|.:||.....:..:::.......|:....||..||......||.|.|||
Zfish   202 TIIYQCLTGKAPFQASTPQELRQFYERNRSLSPSIPRETSSHLRHLLLGLLQRNQRERIDFDDFF 266

  Fly   261 AHPFLDLKTFPTEHTLQKA--IDLVTQACAYDEKHNYKEAYYLYCSALQYFVPLITEETDATKRL 323
            .||||:..|     :::|:  :.:......|....:   ..:...|:.....| ...:|:|.|.|
Zfish   267 HHPFLEAST-----SMKKSSPVPVPVPVPTYPSSGS---GSFSSGSSTSRLTP-TQSDTEAPKSL 322

  Fly   324 ALRNRALSYTKRAEEIKNCIIEDEYRMLAERQRQAATAATANQEPSSATQVPAAQPSSSRVAEML 388
            .        ..:..|....:::|                :::.:......|||...|....||  
Zfish   323 P--------QMKPTESPGSLLKD----------------SSSSDSDDFVMVPAQFTSEPVGAE-- 361

  Fly   389 EPDSRYKQ----------LYALSNSSPSMKTGLEIGRKGELYLYERKLDAALESYTSALGILVPF 443
            ..||..:.          |....:||||.:|...         ..|.|::...||..::.:.|| 
Zfish   362 GQDSLMRSGSSLLGATACLCQTPSSSPSGRTSPR---------PSRHLESCGSSYAQSIPVPVP- 416

  Fly   444 VNNEPKGERRNLLLQQLEFWMKEAESIKSILSAKHLDDEEQKLSTRTSL 492
                  .::.|  .|::|..::|:|  ::..||.|...:......||.:
Zfish   417 ------TQKHN--YQRMEHNLQESE--RTSASAHHCCSDGSPACGRTGV 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 109/263 (41%)
PKc_like 13..264 CDD:304357 107/258 (41%)
MIT_2 274..348 CDD:239147 10/76 (13%)
MIT 407..472 CDD:282117 12/65 (18%)
ulk1aNP_001124103.1 STKc_ULK1 6..272 CDD:271104 110/265 (42%)
S_TKc 9..271 CDD:214567 109/263 (41%)
DUF3543 713..924 CDD:288883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127101
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.