DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Aduk and ulk3

Sequence 1:NP_731331.1 Gene:Aduk FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001082941.1 Gene:ulk3 ZFINID:ZDB-GENE-070410-33 Length:468 Species:Danio rerio

Alignment Length:499 Identity:194/500 (39%)
Similarity:288/500 (58%) Gaps:52/500 (10%)


  Fly     4 PRITDFEILEKLGAGSYATVYKA-RHKKQRTYHAIKYVEMSTLSQTSRENLITEIRLLRELKHKY 67
            |::.||.:.|:||:|:||||||| |....|...|:|.|...:|:::|.|||:|||.:|:.::|.:
Zfish     9 PKLKDFILTERLGSGTYATVYKAFRKTDSREAVAVKVVSKKSLNKSSMENLLTEIEILKTVRHPH 73

  Fly    68 IVTLQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDL 132
            ||.|:||.||.:|||::||:|:.|:||.|||:::.|||...|..|:|:|.|:|::...::||.||
Zfish    74 IVQLKDFQWDSENIYLILEWCSGGDLSRFIRSRRILPERVARRCLQQIACALQFLHERNISHLDL 138

  Fly   133 KPQNLLLTRGANNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSIGVI 197
            ||||:||   :.|: ||::||||||::...:....|:|||||||||||.:..|||:.||||:|||
Zfish   139 KPQNILL---SGNM-LKLSDFGFAQYMSPWDEQHALRGSPLYMAPEIVCRKHYDARVDLWSVGVI 199

  Fly   198 LYECLFGKAPYSSRTIEELLLRIRKAEAITLPPNARISNECHDLLRRLLAHEPTARISFADFFAH 262
            |||.|||:||::||:..||..:||....:.||..|.:|.:|.|||.|||..:|..||.|.:||.|
Zfish   200 LYEALFGRAPFASRSFTELEEKIRSERPVELPAAAGVSRDCRDLLLRLLLRDPDRRICFEEFFLH 264

  Fly   263 PFLDLKTFPTEHTLQKAIDLVTQACAYDEKHNYKEAYYLYCSALQYFVPLITEETDATKRLALRN 327
            ||:||:..|:..:|.||..||.||...|:..:...|..||||||:.|||.|..|||..::.|||.
Zfish   265 PFVDLEHMPSAESLPKAKALVLQAVQKDQDGDRSAALSLYCSALEQFVPAIHYETDRQRKEALRQ 329

  Fly   328 RALSYTKRAEEIKNCIIEDEYRMLAERQRQAATAATANQEPSSATQVPAAQPSSSRVAEMLEPDS 392
            :...|..||||:| .::..:.::..|..|.|...                               
Zfish   330 KVNQYVCRAEELK-ALVRSDNKISFEEARSARNI------------------------------- 362

  Fly   393 RYKQLYALSNSSPSMKTGLEIGRKGELYLYERKLDAA-----LESYTSALGILVPFVNNEPKGER 452
                |..:|...|.:...||:....    ..|:...|     |:.|..:||.::..:..|.:|.|
Zfish   363 ----LIEMSRDQPRLLAALEVASTA----VAREESGAEDYDTLDLYQQSLGEMLLALAAEAQGRR 419

  Fly   453 RNLLLQQLEFWMKEAESIKSILSAKHLDDEE--QKLSTRTSLRT 494
            |.||..:::..|..||.:|.::..:....:|  :|.:...|:|:
Zfish   420 RELLHSEIKSLMSRAEYLKELIKMRETQTDESLKKDAAAESVRS 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdukNP_731331.1 S_TKc 9..265 CDD:214567 130/257 (51%)
PKc_like 13..264 CDD:304357 128/252 (51%)
MIT_2 274..348 CDD:239147 31/74 (42%)
MIT 407..472 CDD:282117 18/70 (26%)
ulk3NP_001082941.1 S_TKc 14..237 CDD:214567 113/227 (50%)
STKc_ULK3 18..266 CDD:271023 128/252 (51%)
MIT 276..350 CDD:294211 31/75 (41%)
MIT 371..442 CDD:294211 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68482
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1084750at2759
OrthoFinder 1 1.000 FOG0005403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.