DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and Msgn1

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_062417.1 Gene:Msgn1 / 56184 MGIID:1860483 Length:188 Species:Mus musculus


Alignment Length:195 Identity:49/195 - (25%)
Similarity:77/195 - (39%) Gaps:56/195 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TADGAGLLA---------------YAPTHPHSYSPSVMGGYEKEAHNMGLLPPTYSVIPQPVSMW 118
            ::|.|||||               .:||...|.:||:               .:||.:..|..  
Mouse    17 SSDTAGLLASWDWKSRARPLELVQESPTQSLSPAPSL---------------ESYSEVALPCG-- 64

  Fly   119 HAGQVATGSPVGLECNKPSELVP--------PPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQ 175
            |:| .:||...|...::.:.||.        .|.|:..:||.              ...:...::
Mouse    65 HSG-ASTGGSDGYGSHEAAGLVELDYSMLAFQPPYLHTAGGL--------------KGQKGSKVK 114

  Fly   176 MEKDYRRTACDRERTRMRDMNRAFDLLRSKL-PISKPNGKKYSKIESLRIAINYINHLQAMLRES 239
            |....||.|.:||:.|||.:..|...||:.| |:....|:..:||::|:..|.||..|..:|..|
Mouse   115 MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNSS 179

  Fly   240  239
            Mouse   180  179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 20/52 (38%)
Msgn1NP_062417.1 HLH 119..173 CDD:278439 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839921
Domainoid 1 1.000 50 1.000 Domainoid score I11580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.