| Sequence 1: | NP_524287.1 | Gene: | sage / 41105 | FlyBaseID: | FBgn0037672 | Length: | 268 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_062417.1 | Gene: | Msgn1 / 56184 | MGIID: | 1860483 | Length: | 188 | Species: | Mus musculus | 
| Alignment Length: | 195 | Identity: | 49/195 - (25%) | 
|---|---|---|---|
| Similarity: | 77/195 - (39%) | Gaps: | 56/195 - (28%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    69 TADGAGLLA---------------YAPTHPHSYSPSVMGGYEKEAHNMGLLPPTYSVIPQPVSMW 118 
  Fly   119 HAGQVATGSPVGLECNKPSELVP--------PPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQ 175 
  Fly   176 MEKDYRRTACDRERTRMRDMNRAFDLLRSKL-PISKPNGKKYSKIESLRIAINYINHLQAMLRES 239 
  Fly   240  239 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| sage | NP_524287.1 | HLH | 181..233 | CDD:278439 | 20/52 (38%) | 
| Msgn1 | NP_062417.1 | HLH | 119..173 | CDD:278439 | 20/53 (38%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167839921 | |
| Domainoid | 1 | 1.000 | 50 | 1.000 | Domainoid score | I11580 | 
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 4 | 3.800 | |||||