DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sage and OLIG1

DIOPT Version :9

Sequence 1:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_620450.2 Gene:OLIG1 / 116448 HGNCID:16983 Length:271 Species:Homo sapiens


Alignment Length:212 Identity:57/212 - (26%)
Similarity:78/212 - (36%) Gaps:79/212 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EQPVLLELGA-----------PQSSSCPAVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKE 97
            ::|..|:|||           |.|||....|.:.|.::        :.|.|              
Human    21 QRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSS--------STTAP-------------- 63

  Fly    98 AHNMGLLPPTYSVIPQPVSMWHAGQVATGSPVGLECNKPSELVPPPMYMSYSGGSIANSTEVDIA 162
                 |||......|:          |...|.|          |.|...::.|||....     |
Human    64 -----LLPKAAREKPE----------APAEPPG----------PGPGSGAHPGGSARPD-----A 98

  Fly   163 KEHNPAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSK-LPISKPN-----GKKYSKIES 221
            ||          :.::..||....|||.||:|:|.|.|.||.. ||.|..:     |:|.|||.:
Human    99 KE----------EQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIAT 153

  Fly   222 LRIAINYINHLQAMLRE 238
            |.:|.|||..|.:.|:|
Human   154 LLLARNYILLLGSSLQE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 26/57 (46%)
OLIG1NP_620450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..117 28/140 (20%)
HLH 107..164 CDD:278439 26/56 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.