DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sage and LOC101732842

Sequence 1:NP_524287.1 Gene:sage FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_004912702.1 Gene:LOC101732842 ID: Length:278 Species:Xenopus tropicalis

Alignment Length:136 Identity:41/137 (30%)
Similarity:66/137 (48%) Gaps:11/137 (8%)


  Fly   111 IPQPVSM---WHAGQVATGSPVGLECN---KP--SELVPP-PMYMSYSGGSIANSTEVDIAKEHN 166
            :||..|.   |......:.||.....:   .|  :.|.|| ..:.:|....:.:.|... .:|..
 Frog     1 MPQDCSQTFEWAYASSCSESPASSSDSYSLSPGYAHLAPPKETFCNYHQAQVYDMTSHQ-TQESP 64

  Fly   167 PAWREKALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPIS-KPNGKKYSKIESLRIAINYIN 230
            ...|....:|....|::|.:||:.|||::::|...||..||.| .|.|:..:|||:||:.|.||:
 Frog    65 QGSRRTRCRMVGPQRQSASEREKMRMRNLSKALQNLRRYLPPSVVPAGRTLTKIETLRLTIRYIS 129

  Fly   231 HLQAML 236
            ||.::|
 Frog   130 HLSSLL 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sageNP_524287.1 HLH 181..233 CDD:278439 25/53 (47%)
LOC101732842XP_004912702.1 HLH 78..131 CDD:278439 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002754
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.