DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pum and PUM5

Sequence 1:NP_001262403.1 Gene:pum FlyBaseID:FBgn0003165 Length:1533 Species:Drosophila melanogaster
Sequence 2:NP_001327304.1 Gene:PUM5 AraportID:AT3G20250 Length:949 Species:Arabidopsis thaliana

Alignment Length:1050 Identity:326/1050 (31%)
Similarity:459/1050 (44%) Gaps:251/1050 (24%)


  Fly   468 SGSPTNK--------DSSLSGLEPHLRNLKFDDNDKSRDDKEKANSPFDTNGLKKDDQVTNSNGV 524
            ||..|.|        ..|:.|....||||.......|.:...:|...:|:     ::::.:....
plant    49 SGDQTGKFPSRSESAPPSMEGSFAALRNLLKQQEGSSSEVLSRAIENYDS-----EEEIRSDPAY 108

  Fly   525 VNGIDDDKGFNRTPGSRQPSPAEESQPRPPNLLFPPL--PFNHMLMDHGQGMGGGLGGVVGSGNG 587
            |.....:...|               ||.|    |||  ..|..|:.|   .|........|.:.
plant   109 VAYYLSNINLN---------------PRLP----PPLISRENQHLLRH---FGDNNQSPTTSWDN 151

  Fly   588 VGGGSGGGGAGGAYAAH------------QQMAAQMS--------QLQPPMMNGVGGGMPMAAQS 632
            :|..|....:..|.:.|            ||..|.::        .:|.|..   .|..|:|...
plant   152 MGIRSSLHSSRTALSTHREEPEDEASSGEQQSYASLAGRRKSIADMIQRPHS---AGNRPIAQDI 213

  Fly   633 PMLNHQAAGPNHMESPG------NLLQQQNFDVQQLFRSQNPGLAAVA----TNAAAAAAAAAAA 687
            ..::...:..:....|.      |||::.:........|::|....:|    |||......|..|
plant   214 HAISSDTSSEHARRLPESDINSVNLLRETDSLSSDAIASEDPFTTDLASQSFTNAQTERLNARQA 278

  Fly   688 TSAASAAAAVGAPPVPNGSLQQSQQQQQQQQQQQQQQQMHMAAASQQFLAAQQQAQNAAYAAQQA 752
            :...:..:..||.|   .|...|:.::.|:.||.|.::|     ..|:..:..|.|  |.:.||.
plant   279 SHEDNNLSVFGASP---PSSVASRMRRNQEDQQSQGRRM-----PPQYTPSSYQVQ--ASSPQQM 333

  Fly   753 TSYVINPGQEAAPYMGMIAAA------QMPYYGVAPWGMY--------------------PGNLI 791
            :...|...|:....:..||..      |.| :|:||..||                    .|..:
plant   334 SYPRIGGTQDMMQSLPKIATGEVHSTFQSP-HGLAPPPMYTSTAAYMTSLSPFYHQNFQSSGMFV 397

  Fly   792 PQQ---GTQPRRPLTPSQQGAENQPYQVIPAFLDHTGSLLMGGPRTGTPMRLVSPAPVLVPPGAT 853
            ||.   |..|...:.|          |.:..:..|..::.|....:.|.....:|.   :.||.:
plant   398 PQYNYGGYPPASGIVP----------QYMSGYPSHEATVPMPYDISSTSSGYNNPR---LLPGVS 449

  Fly   854 RAGPPPPQGPQLYQPQP-QTAQQNLYSQQNGSSVGGLALNTSSLTGRRDSFDRSTSAFSPSTMDY 917
            .:|...|.....:|.|. |.||.:.|:                     ..|..||.:|...  |.
plant   450 SSGQNIPSLVDPFQLQYFQQAQVDAYA---------------------PPFQSSTDSFGQK--DQ 491

  Fly   918 TSSGVAAAANAVNSTVAQAAAAAAAAAAARGKWPGAMSGAASGAYGALGAG-----NASASPLGA 977
            .:.|..|....:||.::...              |..|....|.|.|:..|     ....|||.:
plant   492 QAVGYMANHEPLNSPLSPGY--------------GLQSPRHMGNYFAVPPGVRVMPQYPGSPLAS 542

  Fly   978 PITP--PPSAQSCLLGSRAPGAESRQRQQQQQQLAAVGLPATAAAAQAAVAAAANNMFGSNSSIF 1040
            |:.|  |........|.|   :|:|..||...:                           |:.|:
plant   543 PVMPSSPVGGMMSHFGRR---SETRYHQQGPSR---------------------------NTGIY 577

  Fly  1041 SNPLAIPGTAAVAAAAAAAAAANSRQVAATAAAAAAVAAAAGGVGGAPQPGRSRLLEDFRNQRY- 1104
                  ||                              ...|..|||     |.:::|.:...: 
plant   578 ------PG------------------------------GWQGNRGGA-----SSIVDDLKRHSFL 601

  Fly  1105 -----PN---LQLRDLANHIVEFSQDQHGSRFIQQKLERATAAEKQMVFSEILAAAYSLMTDVFG 1161
                 ||   |:|.|:|..:||||.|||||||||||||..:..||..||||:|..|..|||||||
plant   602 DELKSPNARKLELSDIAGRVVEFSVDQHGSRFIQQKLEHCSDEEKASVFSEVLPQASKLMTDVFG 666

  Fly  1162 NYVIQKFFEFGTPEQKNTLGMQVKGHVLQLALQMYGCRVIQKALESISPEQQQEIVHELDGHVLK 1226
            |||||||.|.|||.|:..|..|:.|.::.|:||||||||||||||.|..:|:.|::.||||:|||
plant   667 NYVIQKFIEHGTPAQREELVKQLAGQMVSLSLQMYGCRVIQKALEVIDVDQKTELIRELDGNVLK 731

  Fly  1227 CVKDQNGNHVVQKCIECVDPVALQFIINAFKGQVYSLSTHPYGCRVIQRILEHCT-AEQTTPILD 1290
            ||:|||||||:|||||.:....:.|:|.||:|||.:||||||||||||||||||: .|:|..|:|
plant   732 CVRDQNGNHVIQKCIESMPAGRIGFVIAAFRGQVATLSTHPYGCRVIQRILEHCSDDEETHCIID 796

  Fly  1291 ELHEHTEQLIQDQYGNYVIQHVLEHGKQEDKSILINSVRGKVLVLSQHKFASNVVEKCVTHATRG 1355
            |:.|....|..|||||||.|||||.||.:::..:|..:.|.|:.:||||:||||||||:.||...
plant   797 EILESAFALAHDQYGNYVTQHVLERGKPDERRQIIEKLTGNVVQMSQHKYASNVVEKCLEHADST 861

  Fly  1356 ERTGLIDEVC--TFNDNALHVMMKDQYANYVVQKMIDVSEPTQLKKLMTKIRPHMAALRKYTYGK 1418
            ||..||:|:.  :..||.|..|||||:|||||||::::|:..|.:.|:.:::.|:.:||||||||
plant   862 EREFLIEEIMGKSEEDNHLLAMMKDQFANYVVQKVLEISKDQQREILVQRMKIHLQSLRKYTYGK 926

  Fly  1419 HINAKLEKYY 1428
            ||.|:.|:.:
plant   927 HIVARFEQLF 936

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pumNP_001262403.1 Pumilio 1106..1424 CDD:153420 189/324 (58%)
PUM5NP_001327304.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12537
Phylome 1 0.910 0.632 Consistency score
33.010

Return to query results.
Submit another query.