DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pum and PUM3

Sequence 1:NP_001262403.1 Gene:pum FlyBaseID:FBgn0003165 Length:1533 Species:Drosophila melanogaster
Sequence 2:NP_001324126.1 Gene:PUM3 AraportID:AT2G29140 Length:964 Species:Arabidopsis thaliana

Alignment Length:1126 Identity:323/1127 (29%)
Similarity:462/1127 (41%) Gaps:307/1127 (27%)


  Fly   426 ILVPPPSRAYAHGGASDTSNSGN----AGIL---SPRDSTCAKVVE-----YVFSGSPTNKDSSL 478
            :::|...|...|.|..|:|...:    .|:|   ..|....|..:|     |....:|...|.||
plant     1 MMIPELGRRPMHRGNEDSSFGDDYEKEIGVLLGEQQRRQVEADELERELNLYRSGSAPPTVDGSL 65

  Fly   479 SGLEPHLRN------LKFDDNDKSR----DDKEKANSP--------------------FDTNGLK 513
            |........      |:|...:|..    ||:|....|                    .....|:
plant    66 SAAGGLFSGGGGASFLEFGGVNKGNGFGGDDEEFRKDPAYLSYYYANMKLNPRLPPPLMSREDLR 130

  Fly   514 KDDQVTNSNGVVNGIDDDKG-------FNRTPGSRQPSPAEESQPRPPNLLFPPLPFNHMLMDHG 571
            ...::..||.|:.|:.|.:.       |:..||.....|...:.....|.|              
plant   131 VAQRLKGSNNVLGGVGDRRKVNDSRSLFSMPPGFEAGKPGASASEWDANGL-------------- 181

  Fly   572 QGMGGGLGGV--------------------------------VGSGNGVG-GGSGGGGAGGAYAA 603
              :|.||||.                                |.|.|.:. ..|.|.||...|..
plant   182 --IGLGLGGKQKSFADIFQADMGHPVVQQPSRPASRNTFDENVDSNNNLSPSASQGIGAPSPYCY 244

  Fly   604 HQQMAAQMSQLQPPMMNGVGGGMPMAAQSPMLNHQAAGPNHMESPGNLLQQQNFDVQQLFRSQNP 668
            ...:.:.:|:...|...|: ..:|....:|:      |...:.|.    .::|...|..|.....
plant   245 AAVLGSSLSRNGTPDPQGI-ARVPSPCLTPI------GSGRVSSN----DKRNTSNQSPFNGVTS 298

  Fly   669 GLAAVATNAAAAAAAAAAATSAASAAAAVGAPPVPNGSLQQSQQQQQQQQQQQQQ----QQMHMA 729
            ||     |.::....|.:..:.:.           .|.|.:..|.:|..::.:..    |..|..
plant   299 GL-----NESSDLVNALSGLNLSG-----------TGGLDERGQAEQDVEKVRNYMFGLQDGHNE 347

  Fly   730 AASQQFLAAQQQA------QNAAYAAQQATSYVINPGQEAA-PYMGMIAAAQMP-YYGVAPWGMY 786
            .....|.....||      :|:.....|.::|  |.|...| ||.    ....| ||.:.|  ..
plant   348 VNPHGFPNRSDQARGTASCRNSQMRGSQGSAY--NSGSGVANPYQ----HHDSPNYYALNP--AV 404

  Fly   787 PGNLIPQQGTQPRRPLTPSQQGAENQPYQVIPAFLDHTGSLLMGGPR------------------ 833
            ...:..|.||....|:  .:..:....|..:.:.| |.||.:..|..                  
plant   405 ASMMANQLGTNNYSPM--YENASATLGYSAMDSRL-HGGSFVSSGQNLSESRNIGRVGNRMMEGG 466

  Fly   834 TGTPMRLVSPAPVLVPPGATRAGPPPPQGPQLYQPQPQTAQQNLYSQQNGSSVGGLALNTSSLTG 898
            ||.|..|..|                                 :|.|.            :..:.
plant   467 TGHPSHLADP---------------------------------MYHQY------------ARFSE 486

  Fly   899 RRDSFDRSTSAFSPSTMDYTSSGVAAAANAVNSTVAQAAAAAAAAAAARGKWPGAMSGAASGAYG 963
            ..||||    ..:..:||                                               
plant   487 NADSFD----LLNDPSMD----------------------------------------------- 500

  Fly   964 ALGAGNASASPLGAPITPPPSAQSCLLGSRAPGAESRQRQQQQQQLAAVGLPATAAAAQAAVAAA 1028
             ...||:..:.|        ..|...|||               |.:..|||..:.:..:. :..
plant   501 -RNYGNSYMNML--------EIQRAYLGS---------------QKSQYGLPYKSGSPNSH-SYY 540

  Fly  1029 ANNMFGSNSSIFSNPLA---IPGTAAVAAAAAAAAAANSRQVAATAAAAAAV-------AAAAGG 1083
            .:..||||.|...:|||   :|.:.....:.......|.|..|||......|       |:...|
plant   541 GSPTFGSNMSYPGSPLAHHGMPNSLMSPYSPMRRGEVNMRYPAATRNYTGGVMGSWHMDASLDEG 605

  Fly  1084 VGGAPQPGRSRLLEDFRNQRYPNLQLRDLANHIVEFSQDQHGSRFIQQKLERATAAEKQMVFSEI 1148
            .|       |.:||:|::.:....:|.::|.|:||||.||:||||||||||.||..||.||:.||
plant   606 FG-------SSMLEEFKSNKTRGFELSEIAGHVVEFSSDQYGSRFIQQKLETATTDEKNMVYEEI 663

  Fly  1149 LAAAYSLMTDVFGNYVIQKFFEFGTPEQKNTLGMQVKGHVLQLALQMYGCRVIQKALESISPEQQ 1213
            :..|.:||||||||||||||||.|.|.|:..||.::..:||.|:||||||||||||:|.:..:|:
plant   664 MPKALALMTDVFGNYVIQKFFEHGLPPQRRELGEKLIDNVLPLSLQMYGCRVIQKAIEVVDLDQK 728

  Fly  1214 QEIVHELDGHVLKCVKDQNGNHVVQKCIECVDPVALQFIINAFKGQVYSLSTHPYGCRVIQRILE 1278
            .::|.||||||::||:|||||||||||||||....::|||:.|.|.|.:|||||||||||||:||
plant   729 IQMVKELDGHVMRCVRDQNGNHVVQKCIECVPEENIEFIISTFFGHVVTLSTHPYGCRVIQRVLE 793

  Fly  1279 HCTAEQT-TPILDELHEHTEQLIQDQYGNYVIQHVLEHGKQEDKSILINSVRGKVLVLSQHKFAS 1342
            ||....| :.:::|:......|.||||||||:||||||||.::::::|..:.||::.:||.||||
plant   794 HCHNPDTQSKVMEEILSTVSMLTQDQYGNYVVQHVLEHGKPDERTVIIKELAGKIVQMSQQKFAS 858

  Fly  1343 NVVEKCVTHATRGERTGLIDEV--CTFNDNALHVMMKDQYANYVVQKMIDVSEPTQLKKLMTKIR 1405
            ||||||:|.....||..|::|:  .|..:..|..|||||:|||||||:::..:..|.:.::|:|:
plant   859 NVVEKCLTFGGPEERELLVNEMLGTTDENEPLQAMMKDQFANYVVQKVLETCDDQQRELILTRIK 923

  Fly  1406 PHMAALRKYTYGKHINAKLEK 1426
            .|:.||:||||||||.|::||
plant   924 VHLNALKKYTYGKHIVARVEK 944

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pumNP_001262403.1 Pumilio 1106..1424 CDD:153420 181/321 (56%)
PUM3NP_001324126.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124534
orthoMCL 1 0.900 OOG5_126869
Panther 1 1.100 O PTHR12537
Phylome 1 0.910 0.696 Consistency score
43.910

Return to query results.
Submit another query.