DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pum and puf-8

Sequence 1:NP_001262403.1 Gene:pum FlyBaseID:FBgn0003165 Length:1533 Species:Drosophila melanogaster
Sequence 2:NP_495523.3 Gene:puf-8 WormBaseID:WBGene00004244 Length:535 Species:Caenorhabditis elegans

Alignment Length:555 Identity:184/556 (33%)
Similarity:279/556 (50%) Gaps:73/556 (13%)


  Fly   906 STSAFSPSTMDYTSSGVAAAANAVNSTVAQAAAAAAAAAAARGKWPGAMSGAASGAYGALGAGNA 970
            :|..|.||.....|.|.:..|..:..:|.                     |:...:||.    :.
 Worm     9 NTCTFDPSASPIESLGRSIGAQKIVDSVC---------------------GSPIRSYGR----HI 48

  Fly   971 SASPLGAPITPPPSAQSCLL---GSRAPGAESRQRQQQQQQLAAVGLPATAAAAQAAVAAAAN-- 1030
            |.:|....:...|..|....   |.:..|         |..|...|.|.:...||..:..::|  
 Worm    49 STNPKNERLPDTPEFQFATYMHQGGKVIG---------QNTLHMFGTPPSCYCAQENIPISSNVG 104

  Fly  1031 -----------NMFGSNSSIFSNPLAIPGTAAVAAAAAAAAAANSRQVAATAAAAAAVAAAAGGV 1084
                       |...:.|::|||.:         .....|.|.|..|:....:.:..|.......
 Worm   105 HVLSTINNNYMNHQYNGSNMFSNQM---------TQMLQAQAYNDLQMHQAHSQSIRVPVQPSAT 160

  Fly  1085 GGAPQPGRSRLLEDFRNQRY-------PNLQLRDLANHIVEFSQDQHGSRFIQQKLERA-TAAEK 1141
            |....|.|.....|....||       .||:|.|:...:::|::||.|||||||:|..: ...||
 Worm   161 GIFSNPYREPTTTDDLLTRYRANPAMMKNLKLSDIRGALLKFAKDQVGSRFIQQELASSKDRFEK 225

  Fly  1142 QMVFSEILAAAYSLMTDVFGNYVIQKFFEFGTPEQKNTLGMQVKGHVLQLALQMYGCRVIQKALE 1206
            ..:|.|:::.|..|:.|:|||||:|||||:|.......|...:...|.:.|.|||.|||:|||||
 Worm   226 DSIFDEVVSNADELVDDIFGNYVVQKFFEYGEERHWARLVDAIIDRVPEYAFQMYACRVLQKALE 290

  Fly  1207 SISPEQQQEIVHELDGHVLKCVKDQNGNHVVQKCIECVDPVALQFIINAF---KGQVYSLSTHPY 1268
            .|:...|.:|:.::...:.:|:|||||||||||.||.|.|..:|||::..   ...:|.:|..||
 Worm   291 KINEPLQIKILSQIRHVIHRCMKDQNGNHVVQKAIEKVSPQYVQFIVDTLLESSNTIYEMSVDPY 355

  Fly  1269 GCRVIQRILEHCTAEQTTPILDELHEHTEQLIQDQYGNYVIQHVLEHGKQEDKSILINSVRGKVL 1333
            ||||:||.||||:..||.|::.::|:..:::..:||||||:|||:|||.:||:.:::..|...:.
 Worm   356 GCRVVQRCLEHCSPSQTKPVIGQIHKRFDEIANNQYGNYVVQHVIEHGSEEDRMVIVTRVSNNLF 420

  Fly  1334 VLSQHKFASNVVEKCVTHATRGERTGLIDEVCTFNDNALHV---MMKDQYANYVVQKMIDVSEPT 1395
            ..:.||::|||:|||:.......::.::...|...:.::.:   ||||||||||||||.|.....
 Worm   421 EFATHKYSSNVIEKCLEQGAVYHKSMIVGAACHHQEGSVPIVVQMMKDQYANYVVQKMFDQVTSE 485

  Fly  1396 QLKKLMTKIRPHMAALRKYTYGKHINAKLEKYYMK 1430
            |.::|:..:|||:..||::.:||||.||||||:.|
 Worm   486 QRRELILTVRPHIPVLRQFPHGKHILAKLEKYFQK 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pumNP_001262403.1 Pumilio 1106..1424 CDD:153420 139/325 (43%)
puf-8NP_495523.3 Pumilio 189..514 CDD:153420 139/325 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5099
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1682
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126869
Panther 1 1.100 O PTHR12537
Phylome 1 0.910 0.625 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1032
TreeFam 1 0.960
87.750

Return to query results.
Submit another query.