DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and AMD1

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_013677.1 Gene:AMD1 SGDID:S000004498 Length:810 Species:Saccharomyces cerevisiae

Alignment Length:414 Identity:82/415 (20%)
Similarity:130/415 (31%) Gaps:132/415 (32%)


  Fly    10 KVELHAHLNGSLGIKSLCDLGERLYGTSCKDFLKLCAHFSRFEKDMDACF---------EKFAFV 65
            ||:.|.|.:..:..|.|               |:...|..|..||....|         |.|..:
Yeast   358 KVDTHVHHSACMNQKHL---------------LRFIKHKLRHSKDEKVIFRDGKLLTLDEVFRSL 407

  Fly    66 HELTSTREGLRFATELAIRD----FAEDNVQY-----VEMRTTPKANENYSRRDYL-----QIVI 116
            | ||.....:......|.:|    |.:.|::|     ..:|.......||.:..||     |::.
Yeast   408 H-LTGYDLSIDTLDMHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTNNYIKGTYLADITKQVIF 471

  Fly   117 D-----------AIKAASETYPE---------------ITVKLLPSINRAEPV-----------D 144
            |           .|.....:..|               ..|:.|..|.|...:           |
Yeast   472 DLENSKYQNCEYRISVYGRSLDEWDKLASWVIDNKVISHNVRWLVQIPRLYDIYKKTGIVQSFQD 536

  Fly   145 VAEETVSLAVELAR---AHPNL------ILGIDLSGNPGK--GRF-------------------- 178
            :.:.......|:.:   :||.|      ::|.|...:..|  .||                    
Yeast   537 ICKNLFQPLFEVTKNPQSHPKLHVFLQRVIGFDSVDDESKVDRRFHRKYPKPSLWEAPQNPPYSY 601

  Fly   179 ------SDFAPILAQARDKG---LKLAIHCAEIENPSEVKE--MLHFGMSRCGHGTFLTPEDIGQ 232
                  |:.|.:......:|   |.|..||.|..:|..:..  :|..|:|   ||..|......|
Yeast   602 YLYYLYSNVASLNQWRAKRGFNTLVLRPHCGEAGDPEHLVSAYLLAHGIS---HGILLRKVPFVQ 663

  Fly   233 ----LKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTT---LTKEFL 290
                |.|..||:. .|::|....|   .:::...|..:......:.|||...|..|   |.:|:.
Yeast   664 YLYYLDQVGIAMS-PLSNNALFLT---YDKNPFPRYFKRGLNVSLSTDDPLQFSYTREPLIEEYS 724

  Fly   291 IAAETFGLTREQCIDLTLEAVHHS 314
            :||:.:.|:.....:|...:|..|
Yeast   725 VAAQIYKLSNVDMCELARNSVLQS 748

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 82/415 (20%)
AMD1NP_013677.1 AMPD 299..794 CDD:238644 82/415 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.