DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and AT4G04880

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001328400.1 Gene:AT4G04880 AraportID:AT4G04880 Length:384 Species:Arabidopsis thaliana

Alignment Length:371 Identity:121/372 (33%)
Similarity:194/372 (52%) Gaps:49/372 (13%)


  Fly     3 QFLKGLPKVELHAHLNGSLGIKSLCDLGERLYGTSCKDFLKLCAHFSRFEKDMDACFEKFAFVHE 67
            ::::.|||:|||||||||:...:|.:|...|.......|..:.....:.::.:...|:.|..:|:
plant     2 EWIQSLPKIELHAHLNGSIRDSTLLELARVLGEKGVIVFADVEHVIQKNDRSLVEVFKLFDLIHK 66

  Fly    68 LTSTREGLRFATELAIRDFAEDNVQYVEMRTTPKANEN--YSRRDYLQIVIDAIKAASET----- 125
            ||:..:.:...|...:.|||.:||.|:|:|||||.:::  .|:|.|::.||..:::.||.     
plant    67 LTTDHKTVTRITREVVEDFALENVVYLELRTTPKRSDSIGMSKRSYMEAVIQGLRSVSEVDIDFV 131

  Fly   126 ----------------YPEITVKLLPSINRAEPVDVAEETV------------------------ 150
                            ..:|.|:||.||:|.|..:.|.|||                        
plant   132 TASDSQKLHNAGDGIGRKKIYVRLLLSIDRRETTESAMETVSVSKQAKLLRILKRLMQKTFDTLL 196

  Fly   151 -SLAVELARAHPNL-ILGIDLSGNPGKGRFSDFAPILAQARDKGLKLAIHCAEIENPSEVKEMLH 213
             ||.|:||....:: ::||||||||..|.:|.|.|.|..|:|..|.:.:||.|:.||.|::.||.
plant   197 FSLKVKLALEMRDVGVVGIDLSGNPLVGEWSTFLPALQYAKDNDLHITLHCGEVPNPKEIQAMLD 261

  Fly   214 FGMSRCGHGTFLTPEDIGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICTDDS 278
            |...|.||..|...||..:||...|.:|.|||||:.:.::.|::.||...:..|..|.::||||.
plant   262 FKPHRIGHACFFKDEDWTKLKSFRIPVEICLTSNIVTKSISSIDIHHFADLYNAKHPLILCTDDF 326

  Fly   279 GVFDTTLTKEFLIAAETFGLTREQCIDLTLEAVHHSFASEQEQIQM 324
            |||.|:|:.|:.:|..:.||::.:...|...|:..:||.::.:.|:
plant   327 GVFSTSLSNEYALAVRSLGLSKSETFALARAAIDATFAEDEVKQQL 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 121/367 (33%)
AT4G04880NP_001328400.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H13827
Inparanoid 1 1.050 213 1.000 Inparanoid score I1209
OMA 1 1.010
OrthoDB 1 1.010 D981145at2759
OrthoInspector 1 1.000 T192805
orthoMCL 1 0.900 OOG5_127245
Panther 1 1.100 LDO PTHR11409
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.