DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and ampd3

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001025687.1 Gene:ampd3 XenbaseID:XB-GENE-984137 Length:781 Species:Xenopus tropicalis

Alignment Length:443 Identity:84/444 (19%)
Similarity:138/444 (31%) Gaps:146/444 (33%)


  Fly    10 KVELHAHLNGSLGIKSLCDLGER-----------LYGTSC---KDFLKLCAHFSRFEKDMDACFE 60
            |..||..||....:|.|..:..|           ::..:|   |..|:...|..|.|.|. ...|
 Frog   298 KFNLHEMLNEMAELKELKSVPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYRTEPDR-VVTE 361

  Fly    61 KFAFVHELTSTREGLRF-------------ATELAIRDFAEDNVQY-----VEMRTTPKANENYS 107
            :......|....|||..             |.......|.:.|.:|     .|:|......|||.
 Frog   362 RNGQGVTLKELFEGLHMDPYDLTVDSLDVHAGRQTFHRFDKFNAKYNPVGASELRDLYLKTENYI 426

  Fly   108 RRDYL-QIVIDAIKAASETYPEITVKLLPSINRAEPVDVAEETVSLA---VELARAHPNLILGID 168
            ..:|. :|:.:..:...|:..:.|...|....||     .||..|||   ::.....||:...|.
 Frog   427 GGEYFARIIKEVAQELEESKYQYTEPRLSIYGRA-----PEEWDSLAKWFIKHKLYSPNMRWMIQ 486

  Fly   169 LSGNP-------GKGRFSDFAPILAQARDKGLKLAIHCAEIENPSEVKEM--------------- 211
            :   |       .|....||..::     :.:.|.:..|.| ||::.||:               
 Frog   487 V---PRIYDIFRSKKILPDFGKMM-----ENIFLPLFEATI-NPTDHKELYLFLNYVTGFDSVDD 542

  Fly   212 ------------------------------LHF---------------GMS------RCGH---- 221
                                          |:|               |||      .||.    
 Frog   543 ESKHSDHMFSYKSPNPDEWCHEQNPPYSYYLYFMYANIMLLNNLRKERGMSTFLFRPHCGEAGSI 607

  Fly   222 ----GTFLTPEDIG---QLKQRNI--------AIECCLTSNVKSGTVPSLEEHHLKRIMEADAPK 271
                ..|:|.::|.   .||:..:        .|...::....:.......::.|:..:......
 Frog   608 THLVSAFITADNISHGLNLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLVV 672

  Fly   272 VICTDDSGVFDTT---LTKEFLIAAETFGLTREQCIDLTLEAVHHSFASEQEQ 321
            .:.|||...|..|   |.:|:.|||:.:.|:.....::...:|..|..|::|:
 Frog   673 SLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSDKEK 725

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 84/444 (19%)
ampd3NP_001025687.1 metallo-dependent_hydrolases 158..767 CDD:320877 84/444 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.