DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and ADA2

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001269154.1 Gene:ADA2 HGNCID:1839 Length:511 Species:Homo sapiens

Alignment Length:338 Identity:82/339 (24%)
Similarity:142/339 (42%) Gaps:68/339 (20%)


  Fly    39 KDFLKLCAHFSRFEKDMDACFEKFAFV--H-ELTSTREGL---RFATEL---------------- 81
            :|:.|...:.:.|:   |:....|..|  | |:..|.:.:   :|.|..                
Human   166 EDYRKRVQNVTEFD---DSLLRNFTLVTQHPEVIYTNQNVVWSKFETIFFTISGLIHYAPVFRDY 227

  Fly    82 ---AIRDFAEDNVQYVEMR---------TTPKANENYSRRDYLQIVIDAIKAASETYPE-ITVKL 133
               ::::|.||||.|:|:|         :....:|.:|.:.|.::....:    ||:|| |.:|:
Human   228 VFRSMQEFYEDNVLYMEIRARLLPVYELSGEHHDEEWSVKTYQEVAQKFV----ETHPEFIGIKI 288

  Fly   134 LPSINRAEPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGR-FSDFAPILAQARDKGLKLA- 196
            :.|.:|::.|.|..|::.:|:.|....|.::.|.||.|:...|. ..|:...|......|:||. 
Human   289 IYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPY 353

  Fly   197 -IHCAEIE-----NPSEVKEMLHFGMSRCGHGTFLT--PEDIGQLKQRNIAIECCLTSNVKSGTV 253
             .|..|.:     ....:.:.|....:|.|||..|:  |.......:::|.||.|..||.....|
Human   354 FFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLV 418

  Fly   254 PSLEEHHLKRIMEADAPKVICTDDSGVFDTT-LTKEFLIAAETF----GL-----TREQCIDLTL 308
            ..|..|.:..:|....|.||.:||..:|... |:.:|.   |.|    |:     |.:|   |.:
Human   419 SDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFY---EVFMGIGGMKADLRTLKQ---LAM 477

  Fly   309 EAVHHSFASEQEQ 321
            .::.:|...|.|:
Human   478 NSIKYSTLLESEK 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 82/339 (24%)
ADA2NP_001269154.1 A_deaminase_N 12..102 CDD:285627
adm_rel 30..509 CDD:273620 82/339 (24%)
Dimerization 30..100
ADGF 82..501 CDD:238646 82/339 (24%)
PRB domain 127..185 4/22 (18%)
Substrate binding 204..211 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.