DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and Adgf-B

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_649006.2 Gene:Adgf-B FlyBaseID:FBgn0036751 Length:520 Species:Drosophila melanogaster

Alignment Length:354 Identity:88/355 (25%)
Similarity:138/355 (39%) Gaps:68/355 (19%)


  Fly     5 LKGLPK-VELHAHLNGSLGIKSLCDLGER--LYGTSCKDFLKLCA-HFSRFE------------- 52
            :||:|| ..||||.........|..|..|  |:..:.::..|..| .||:.|             
  Fly   113 IKGMPKGGALHAHDTALCSTDYLISLTYRKNLWICTAEEGCKAIAFRFSKEEPKEKPVKESIWEP 177

  Fly    53 --------------KDMDACFEKFAFVHELTSTR------------EGLRFATEL-------AIR 84
                          |.:...|..:.|...:::.:            :||.....:       |::
  Fly   178 MEEFRERRGEENVTKYLTRRFSMYPFSKFISNNQAWAHFMGIFILLDGLLCHAPIWAEYYYNALK 242

  Fly    85 DFAEDNVQYVEMRT-TPKA----NENYSRRDYLQIVIDAIKAASETYPE-ITVKLLPSINRAEPV 143
            :||||.|||:|:|: .|..    .:..:.||.:.|....::.....:|: |..||:.:..|....
  Fly   243 EFAEDGVQYLELRSLLPPLYCIDGDMLTIRDTVAIYNSELERFRADHPDFIGSKLIYAPLRGVEP 307

  Fly   144 DVAEETVSLAVELARAHPNLILGIDLSGNPGKGR-FSDFA-PILAQARDKGLKLAIHCAEIE--- 203
            .|.|:.|..||||.:..||.::|.||.|....|| ..||. |:|..  .:.:....|..|..   
  Fly   308 SVVEQYVKTAVELNKEFPNFMVGFDLVGQEELGRPLIDFVEPLLKM--PEHINFYFHAGETNWFG 370

  Fly   204 NP--SEVKEMLHFGMSRCGHGTFLT--PEDIGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRI 264
            :|  ..:.:.:..|..|.|||..:|  |..:...|...||||.|..||...........|....:
  Fly   371 SPIDENLVDAILLGTKRIGHGYAITKHPMMMRLAKLLGIAIEVCPVSNQVLQLGVDYRNHPAALL 435

  Fly   265 MEADAPKVICTDDSGVFD-TTLTKEFLIA 292
            :.|:.|.||.:||...:. ..|:.:|..|
  Fly   436 LAANVPIVISSDDPSFWHCAPLSHDFYFA 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 86/352 (24%)
Adgf-BNP_649006.2 A_deaminase_N 36..113 CDD:285627 88/355 (25%)
adm_rel 56..515 CDD:273620 88/355 (25%)
ADGF 93..507 CDD:238646 88/355 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28351610
eggNOG 1 0.900 E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11409
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.