DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and ampd1

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_017212786.1 Gene:ampd1 ZFINID:ZDB-GENE-040426-1906 Length:723 Species:Danio rerio

Alignment Length:155 Identity:44/156 (28%)
Similarity:68/156 (44%) Gaps:26/156 (17%)


  Fly   184 ILAQAR-DKGL---KLAIHCAEIENPSEVKEMLHFGMS--RCGHGTFLTPEDIGQ----LKQRNI 238
            ||.|.| ::|:   :...||.|   ...|..:|...|:  ...||..|....:.|    |.|..|
Zfish   531 ILNQLRKERGMNTFQFRPHCGE---AGAVTHLLACFMTADNISHGLNLKKSPVLQYLYYLAQVPI 592

  Fly   239 AIECCLTSN---VKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTT---LTKEFLIAAETFG 297
            |:. .|::|   ::....|.| |.|.|.:|.:     :.|||...|..|   |.:|:.|||:.|.
Zfish   593 AMS-PLSNNSLFLEYNKNPLL-EFHKKGLMVS-----LSTDDPMQFHYTKEPLMEEYAIAAQVFK 650

  Fly   298 LTREQCIDLTLEAVHHSFASEQEQI 322
            |:.....::...:|..|..|.:|:|
Zfish   651 LSTCDMCEIARNSVLQSGLSAEEKI 675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 44/156 (28%)
ampd1XP_017212786.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.