DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and AMPdeam

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001285233.1 Gene:AMPdeam FlyBaseID:FBgn0052626 Length:798 Species:Drosophila melanogaster

Alignment Length:352 Identity:73/353 (21%)
Similarity:122/353 (35%) Gaps:95/353 (27%)


  Fly     2 EQFLKGLPKVELHAHLNGSLG---IKSLC-DLGE----------RLYGTSCKDFLKLCAHFSRFE 52
            |.|||      ...:|||...   ||.:. ||.|          .:||.|..::.||    :::.
  Fly   433 EVFLK------TDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKL----AKWA 487

  Fly    53 KDMDACFEKFAFVHELTSTREGLRFATELAIRDFAE--DNVQYVEMRTTPKANENYSRRDYLQIV 115
            .|.|.......::.::....:  .|.:...::.|.|  :|:.......|.:.:::.....:||.|
  Fly   488 IDNDVYSSNIRWLIQIPRLFD--IFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYV 550

  Fly   116 IDAIKAASETYPEITVKLLPSINRAEPVDVA-------EETVSLAVELARAHPNLILGIDLSGNP 173
            |.......|:.||         |.....||.       ||....|..:...:.|:.:        
  Fly   551 IGFDSVDDESKPE---------NPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTV-------- 598

  Fly   174 GKGRFSDFAPILAQARDKG-LKLAIHCAEIENPSEVKEMLHFGMSRCG--------HGTFLTPED 229
                .:.|    .|:|:.. ..|..||.|   ...|:.::      ||        ||..|....
  Fly   599 ----LNKF----RQSRNMNTFVLRPHCGE---AGPVQHLV------CGFLMAENISHGLLLRKVP 646

  Fly   230 IGQ----LKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVI---CTDDSGVFDTT--- 284
            :.|    |.|..||:.....:::       ...:|...:.|..|..:|   .|||...|..|   
  Fly   647 VLQYLYYLTQIGIAMSPLSNNSL-------FLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEP 704

  Fly   285 LTKEFLIAAETFGLTREQCIDLTLEAV 311
            |.:|:.|||:.:.|:.....:|...:|
  Fly   705 LMEEYSIAAQVWKLSSCDMCELARNSV 731

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 69/347 (20%)
AMPdeamNP_001285233.1 PLN03055 248..784 CDD:178613 73/353 (21%)
AMPD 284..780 CDD:238644 73/353 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.