DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and Adal

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_008760388.1 Gene:Adal RGDID:1359517 Length:360 Species:Rattus norvegicus

Alignment Length:338 Identity:135/339 (40%)
Similarity:203/339 (60%) Gaps:21/339 (6%)


  Fly     4 FLKGLPKVELHAHLNGSLGIKSLCDLGERLYGTSCKDFLKLCAHFSRFEK----DMDACFEKFAF 64
            |...|||||||||||||:...::..|      .:.|..|::..|.:..:|    .::.||:.|..
  Rat    13 FYMQLPKVELHAHLNGSISSSTMRKL------IAKKPHLQVHGHMTMIDKGKKRTLEECFQMFQV 71

  Fly    65 VHELTSTREGLRFATELAIRDFAEDNVQYVEMRTTPKANEN---YSRRDYLQIVIDAIKAASETY 126
            :|:||::.|.:...|:..|::||:|.|:|:|:|:||: .||   .:|:.|::.|::.||...:..
  Rat    72 IHQLTTSAEDILMVTKDVIKEFADDGVKYLELRSTPR-GENATGMTRKTYVESVLEGIKQCKQEN 135

  Fly   127 PEITVKLLPSINRAEPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGRFSDFAPILAQARDK 191
            .:|.|:.|.:|:|.....||:|||.||.|...:..:.:||:||||:|..|:..||...|.:|:..
  Rat   136 LDIDVRYLMAIDRKGGPTVAKETVKLAKEFFLSAEDTVLGLDLSGDPTIGQAKDFLEPLLEAKKA 200

  Fly   192 GLKLAIHCAEIEN-PSEVKEMLHFGMSRCGHGTFL-TPE-----DIGQLKQRNIAIECCLTSNVK 249
            |||||:|.|||.| ..|.:.:|.....|.|||||| |||     .:..::|..|.:|.|||||:|
  Rat   201 GLKLALHLAEIPNKEKETQMLLDLLPDRIGHGTFLNTPEAGSVDQVNFVRQHRIPLELCLTSNIK 265

  Fly   250 SGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTTLTKEFLIAAETFGLTREQCIDLTLEAVHHS 314
            |.||||.::||.........|.||||||.|||.|:|::|:.:|||||.||..|..||:.|::::.
  Rat   266 SQTVPSYDQHHFGFWYSVAHPSVICTDDKGVFATSLSQEYQLAAETFNLTPSQVWDLSYESINYI 330

  Fly   315 FASEQEQIQMADR 327
            |||...:.::..|
  Rat   331 FASNNTRSELRKR 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 133/333 (40%)
AdalXP_008760388.1 ADA_AMPD 17..344 CDD:238250 134/335 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28328720
eggNOG 1 0.900 E1_COG1816
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D511781at33208
OrthoFinder 1 1.000 FOG0006087
OrthoInspector 1 1.000 T1087786
orthoMCL 1 0.900 OOG5_127245
Panther 1 1.100 LDO PTHR11409
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.710

Return to query results.
Submit another query.