DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Ampd2

DIOPT Version :10

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001276649.1 Gene:Ampd2 / 109674 MGIID:88016 Length:835 Species:Mus musculus


Alignment Length:113 Identity:26/113 - (23%)
Similarity:45/113 - (39%) Gaps:26/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PED--IGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRI------MEADAPKVICTD------D 277
            ||:  |.||::|...:|..::.:||      ||...|.|.      .::|:...:..:      |
Mouse    93 PEESPIEQLEERRQRLERQISQDVK------LEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGD 151

  Fly   278 SGVF--DTTLTKEF----LIAAETFGLTREQCIDLTLEAVHHSFASEQ 319
            .|::  |..|.:||    :...|..|:.....:|.....|...|..|:
Mouse   152 RGLWERDVVLEREFQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 26/113 (23%)
Ampd2NP_001276649.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
AMP_deaminase 163..817 CDD:437158 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.