DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Ampd2

DIOPT Version :9

Sequence 1:NP_649866.1 Gene:Ada / 41092 FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001276649.1 Gene:Ampd2 / 109674 MGIID:88016 Length:835 Species:Mus musculus


Alignment Length:113 Identity:26/113 - (23%)
Similarity:45/113 - (39%) Gaps:26/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PED--IGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRI------MEADAPKVICTD------D 277
            ||:  |.||::|...:|..::.:||      ||...|.|.      .::|:...:..:      |
Mouse    93 PEESPIEQLEERRQRLERQISQDVK------LEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGD 151

  Fly   278 SGVF--DTTLTKEF----LIAAETFGLTREQCIDLTLEAVHHSFASEQ 319
            .|::  |..|.:||    :...|..|:.....:|.....|...|..|:
Mouse   152 RGLWERDVVLEREFQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 26/113 (23%)
Ampd2NP_001276649.1 PLN03055 198..811 CDD:178613 1/2 (50%)
AMPD 301..808 CDD:238644
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.