DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ada and ada2

Sequence 1:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_017944930.1 Gene:ada2 XenbaseID:XB-GENE-6258151 Length:271 Species:Xenopus tropicalis

Alignment Length:77 Identity:22/78 (28%)
Similarity:32/78 (41%) Gaps:4/78 (5%)


  Fly   208 VKEMLHFGMSRCGHGTFLTPEDIGQ---LKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADA 269
            |.:.|....:|.|||..|....:.:   ||. .:.:|.|..||.....|..|..|....:|....
 Frog   123 VLDALLLNTTRIGHGYALLKHPVARNLSLKM-EVPLEICPISNQVLLLVSDLRNHPAAVLMAEGH 186

  Fly   270 PKVICTDDSGVF 281
            |.|:.:||..:|
 Frog   187 PLVVSSDDPSIF 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 22/78 (28%)
ada2XP_017944930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.