DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RagA-B and Rragb

DIOPT Version :10

Sequence 1:NP_649850.1 Gene:RagA-B / 41071 FlyBaseID:FBgn0037647 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_446424.1 Gene:Rragb / 117043 RGDID:619805 Length:374 Species:Rattus norvegicus


Alignment Length:324 Identity:240/324 - (74%)
Similarity:265/324 - (81%) Gaps:28/324 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTTRLGATI--------------------------- 38
            |||||||||||||||||||||||||||||||.||||||                           
  Rat    39 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKT 103

  Fly    39 -DVEHSHVRFLGNLVLNLWDCGGQEGFMKQYFAQQRDNIFRNVEVLIYVFDVESQEIERDIHYYQ 102
             |||||||||||||||||||||||:.||:.||..||||||||||||||||||||:|:|:|:||||
  Rat   104 FDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQ 168

  Fly   103 SCLEALLQNSPEAKIFCLVHKMDLVPEGLRESVFTERMEDLIKLSKPGNVTCFRTSIWDETLYKA 167
            |||||:|||||||||||||||||||.|..|:.:|.||.|||.:||:|...:||||||||||||||
  Rat   169 SCLEAILQNSPEAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKA 233

  Fly   168 WSSIVTMLIPNVAALENSVTHFGNVIEADEVLLFEKATFLVISHCQSKKNRDSHRFEKVSNIIKQ 232
            |||||..|||||..||.::.:|..:||||||||||:||||||||.|.|:.||:|||||:||||||
  Rat   234 WSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQ 298

  Fly   233 FKLSCSKLGAKFQSMEVRNSAFAAFIDTFTSNTYVMVVMSDPTLPSEATLVNIRNARKYFEELE 296
            ||||||||.|.|||||||||.||||||.||||||||||||||::||.|||:|||||||:||:||
  Rat   299 FKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RagA-BNP_649850.1 RagA_like 4..287 CDD:206744 228/310 (74%)
RragbNP_446424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
RagA_like 42..353 CDD:206744 228/310 (74%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.