DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RagA-B and RragB

DIOPT Version :8

Sequence 1:NP_649850.1 Gene:RagA-B / 41071 FlyBaseID:FBgn0037647 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_446424.1 Gene:RragB / 117043 RGDID:619805 Length:374 Species:Rattus norvegicus

Alignment Length:324 Identity:240/325 (74%)
Similarity:265/325 (82%) Gaps:28/325 (9%)


  Fly     1 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTTRLGATI--------------------------- 38
            |||||||||||||||||||||||||||||||.||||||                           
  Rat    39 MKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKT 103

  Fly    39 -DVEHSHVRFLGNLVLNLWDCGGQEGFMKQYFAQQRDNIFRNVEVLIYVFDVESQEIERDIHYYQ 102
             |||||||||||||||||||||||:.||:.||..||||||||||||||||||||:|:|:|:||||
  Rat   104 FDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQ 168

  Fly   103 SCLEALLQNSPEAKIFCLVHKMDLVPEGLRESVFTERMEDLIKLSKPGNVTCFRTSIWDETLYKA 167
            |||||:|||||||||||||||||||.|..|:.:|.||.|||.:||:|...:||||||||||||||
  Rat   169 SCLEAILQNSPEAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKA 233

  Fly   168 WSSIVTMLIPNVAALENSVTHFGNVIEADEVLLFEKATFLVISHCQSKKNRDSHRFEKVSNIIKQ 232
            |||||..|||||..||.::.:|..:||||||||||:||||||||.|.|:.||:|||||:||||||
  Rat   234 WSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQ 298

  Fly   233 FKLSCSKLGAKFQSMEVRNSAFAAFIDTFTSNTYVMVVMSDPTLPSEATLVNIRNARKYFEELE 296
            ||||||||.|.|||||||||.||||||.||||||||||||||::||.|||:|||||||:||:||
  Rat   299 FKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLE 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RagA-BNP_649850.1 Gem1 2..>146 CDD:224025 122/172 (71%)
RagA_like 4..287 CDD:206744 229/311 (74%)
RragBNP_446424.1 RagA_like 42..353 CDD:206744 229/311 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25503208
eggNOG 1 0.900 E1_KOG3886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11259
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.