DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11964 and Ctnnbl1

Sequence 1:NP_649847.1 Gene:CG11964 FlyBaseID:FBgn0037644 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_079956.3 Gene:Ctnnbl1 MGIID:1913892 Length:563 Species:Mus musculus

Alignment Length:592 Identity:328/593 (55%)
Similarity:431/593 (73%) Gaps:40/593 (7%)


  Fly     1 MDIGELLAFKPEQTPKRPHDDEDDEFDLASSHGKRGGVDEKTKRMRRIADAKESAHYVKQSGGAT 65
            ||:||||:::|.:..|||.|||::|.              ||:|.:  ...:|...|.::...|.
Mouse     1 MDVGELLSYQPNRGTKRPRDDEEEEL--------------KTRRKQ--TGPRERGRYREEEATAA 49

  Fly    66 GGSGTSAFEFDPELTEEERLNILKYV----ENEEADGDVLDEQSLKKLILVFEKRNLKNQEMRIK 126
                        |.|.:::..:|:.:    |.||.:.:.|||.|:||:||.||||:.||||:|||
Mouse    50 ------------EDTADDKKRLLQIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIK 102

  Fly   127 FADSPEKFMDSEVELHTVIQELKGVATVPDLYPILVDLHGLHSLLELLAHQNTDIAVAVVDLLQE 191
            |.|:|||||:||::|:.:|||:..|||:||||.:||:|..:.|||.||.|.|||:::||||||||
Mouse   103 FPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVVDLLQE 167

  Fly   192 VTDVDILGESQEGAESLIEALRKEQICALLVQNLERLNEQVKEEADGVHNTLAIVENLTEIDSEF 256
            :||:|.|.||:||||.||:||...|:.||||||||||:|.|:|||||||||||||||:.|...|.
Mouse   168 LTDIDTLHESEEGAEVLIDALVDGQVAALLVQNLERLDESVREEADGVHNTLAIVENMAEFRPEM 232

  Fly   257 VKEAAEQGLLAWLLKRLRGKSPFDPNKLYCSEILSILIQTENENRLLLGSLDGVDVLLQQLAVYK 321
            ..|||:||||.||||||:.|.|||.|||||||:|:||:|..:|||.|||.|||:|||||||:|:|
Mouse   233 CTEAAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFK 297

  Fly   322 RHDPASNEEQEYMQNLFNCLCSALMARENRDRFLSGEGLQLMNLMLREKKMSRNGSLKVLDHAMA 386
            ||:|::.||||.|:|||:.|||.||...||:|||.|||||||||||||||:||:.:||||||||.
Mouse   298 RHNPSTAEEQEMMENLFDALCSCLMLSSNRERFLKGEGLQLMNLMLREKKVSRSSALKVLDHAMI 362

  Fly   387 GQDGRDNCNKFVEILGLRTIFPLFMKTPKRNKQRLISADEHEEHVTSVIASMLRNCKGTHRQRML 451
            |.:|.|||:|||:|||||||||||||:|::.|:...:..||||||.|::||:|||.:|..|.|:|
Mouse   363 GPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRGQQRTRLL 427

  Fly   452 AKFTENDHEKVDRLLELHLKYLAKVEAIDKEIDQQAKD-----PTIDEDEEAENNYIKRLTGGLF 511
            .||||||.||||||:|||.|||:.::..||:|:.:..|     ..||.|.|.| .|::||..|||
Mouse   428 NKFTENDSEKVDRLMELHFKYLSAMQVADKKIEGEKHDIVRRGEIIDNDMEDE-FYLRRLDAGLF 491

  Fly   512 TLQRIDYILLEV-SATGDTVKQRVLQILNLRGASMKTIRSIMREYAGNLGDG-DTDWREQEQNHI 574
            .||.|.||:.|: :|....::|||.||||:||:|:|.:|.|::|||.|:||| ..::||.||..|
Mouse   492 ILQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRETEQKRI 556

  Fly   575 LSLVDRF 581
            |:|::.|
Mouse   557 LALLENF 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11964NP_649847.1 CTNNBL 87..183 CDD:285433 55/100 (55%)
ARM <155..251 CDD:237987 66/96 (69%)
Ctnnbl1NP_079956.3 Nuclear localization signal. {ECO:0000250} 16..33 10/33 (30%)
CTNNBL 57..159 CDD:285433 55/102 (54%)
HEAT 1 79..129 32/50 (64%)
ARM <125..227 CDD:237987 69/102 (68%)
Nuclear export signal (NES). {ECO:0000250} 130..140 6/10 (60%)
HEAT 2 134..176 25/42 (60%)
ARM 1 178..228 37/50 (74%)
ARM 186..294 CDD:237987 76/108 (70%)
ARM 2 229..273 29/44 (66%)
ARM 3 274..323 34/49 (69%)
ARM 4 325..363 30/38 (79%)
ARM 5 364..417 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C305397851
eggNOG 1 0.900 E1_KOG2734
Hieranoid 1 1.000
Homologene 1 1.000 H12003
Inparanoid 1 1.050 617 1.000 Inparanoid score I881
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005177
OrthoInspector 1 1.000 T1084240
orthoMCL 1 0.900 OOG5_129481
Panther 1 1.100 LDO PTHR14978
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1951
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.