DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11964 and ctnnbl1

Sequence 1:NP_649847.1 Gene:CG11964 FlyBaseID:FBgn0037644 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_957160.1 Gene:ctnnbl1 ZFINID:ZDB-GENE-040426-1850 Length:563 Species:Danio rerio

Alignment Length:587 Identity:318/588 (54%)
Similarity:424/588 (72%) Gaps:30/588 (5%)


  Fly     1 MDIGELLAFKPEQTPKRPHDDEDDEFDLASSHGKRGGVDEKTKRMRRIADAKESAHYVKQSGGAT 65
            ||:||||.::|::..|||.|  .|..:.:.|..|..|.|.....:|...:.:|          .|
Zfish     1 MDVGELLNYQPDRGAKRPRD--GDSHEESRSKQKAAGRDAGRVLLRSEDNTEE----------PT 53

  Fly    66 GGSGTSAFEFDPELTEEERLNILKYVENEEADGDVLDEQSLKKLILVFEKRNLKNQEMRIKFADS 130
            .|.|....|   .|.::         :.|:.:.:::||.::||:||.||||:.||||:||||.|:
Zfish    54 AGDGDKVLE---RLMDQ---------DGEDPEAELVDESTVKKMILTFEKRSYKNQELRIKFPDN 106

  Fly   131 PEKFMDSEVELHTVIQELKGVATVPDLYPILVDLHGLHSLLELLAHQNTDIAVAVVDLLQEVTDV 195
            |||||::|::|:.:|||:..:||:|:||.:||:|:.:.|||.||:|.||||::||||||||:||:
Zfish   107 PEKFMEAELDLNDIIQEMHVIATIPELYHLLVELNAVQSLLGLLSHDNTDISIAVVDLLQELTDI 171

  Fly   196 DILGESQEGAESLIEALRKEQICALLVQNLERLNEQVKEEADGVHNTLAIVENLTEIDSEFVKEA 260
            |.|.||:||||.||:||.:.|:.||:|||:|||:|.||||||||:||||::||:.|.......||
Zfish   172 DTLHESEEGAEVLIDALLEGQVVALMVQNMERLDETVKEEADGVYNTLAVIENMAEFRPGLCTEA 236

  Fly   261 AEQGLLAWLLKRLRGKSPFDPNKLYCSEILSILIQTENENRLLLGSLDGVDVLLQQLAVYKRHDP 325
            |:|||:.|||||::.|.|||.|||||||||:||:|..::.|.|||.:||:|||||||:|:|||:|
Zfish   237 AQQGLMQWLLKRIKAKMPFDANKLYCSEILAILLQNNDKTRELLGEMDGIDVLLQQLSVFKRHNP 301

  Fly   326 ASNEEQEYMQNLFNCLCSALMARENRDRFLSGEGLQLMNLMLREKKMSRNGSLKVLDHAMAGQDG 390
            ::.||||.|:|||:.|||.||...||||||.||||||||||||||||||..:|||||:.|.|.:|
Zfish   302 STAEEQEMMENLFDALCSCLMLPANRDRFLRGEGLQLMNLMLREKKMSRVSALKVLDYGMIGPEG 366

  Fly   391 RDNCNKFVEILGLRTIFPLFMKTPKRNKQRLISADEHEEHVTSVIASMLRNCKGTHRQRMLAKFT 455
            .|||:|||:||||||||||||||||:.|:..||..:|||||.|:|||||||.||..|.|:|:|||
Zfish   367 SDNCHKFVDILGLRTIFPLFMKTPKKMKKVGISDKQHEEHVCSIIASMLRNLKGQQRSRLLSKFT 431

  Fly   456 ENDHEKVDRLLELHLKYLAKVEAIDKEIDQQAKDPT----IDEDEEAENNYIKRLTGGLFTLQRI 516
            |||.||||||:|||.|||..|:..||.|:.:..|..    |.:|...:..|::||..|||.||.:
Zfish   432 ENDCEKVDRLMELHFKYLEAVQLADKRIEGEKHDMVRRGEILDDAMDDEFYLRRLDAGLFVLQLL 496

  Fly   517 DYILLEVSATG-DTVKQRVLQILNLRGASMKTIRSIMREYAGNLGDGDT-DWREQEQNHILSLVD 579
            .||::|:.|.| ..::|||.|||||||.|:|.:|.||||||.|:|||.: :::|.||..|:.|::
Zfish   497 CYIMVEICAAGVPQLQQRVHQILNLRGGSVKVVRHIMREYAENIGDGKSEEFKESEQKRIMELLE 561

  Fly   580 RF 581
            .|
Zfish   562 NF 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11964NP_649847.1 CTNNBL 87..183 CDD:285433 48/96 (50%)
ARM <155..251 CDD:237987 62/96 (65%)
ctnnbl1NP_957160.1 CTNNBL 61..159 CDD:285433 50/110 (45%)
ARM <125..220 CDD:237987 61/95 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C305401897
eggNOG 1 0.900 E1_KOG2734
Hieranoid 1 1.000
Homologene 1 1.000 H12003
Inparanoid 1 1.050 602 1.000 Inparanoid score I893
OMA 1 1.010
OrthoDB 1 1.010 D387271at33208
OrthoFinder 1 1.000 FOG0005177
OrthoInspector 1 1.000 T1053423
orthoMCL 1 0.900 OOG5_129481
Panther 1 1.100 LDO PTHR14978
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1951
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.