DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11964 and Ctnnbl1

Sequence 1:NP_649847.1 Gene:CG11964 FlyBaseID:FBgn0037644 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001020041.1 Gene:Ctnnbl1 RGDID:1563558 Length:563 Species:Rattus norvegicus

Alignment Length:597 Identity:330/598 (55%)
Similarity:430/598 (72%) Gaps:50/598 (8%)


  Fly     1 MDIGELLAFKPEQTPKRPHDDEDDEFDLASSHGKRGGVDEKTKRMRRIADAKESAHYVKQSGGAT 65
            ||:||||:::|.:..|||.|||::|.              ||:|              ||:|...
  Rat     1 MDVGELLSYQPNRGTKRPRDDEEEEL--------------KTRR--------------KQTGPRE 37

  Fly    66 GG-----SGTSAFEFDPELTEEERLNILKYV----ENEEADGDVLDEQSLKKLILVFEKRNLKNQ 121
            .|     ..|:|     |..::::..:|:.:    |.||.:.:.|||.|:||:||.||||:.|||
  Rat    38 RGRYREDEATAA-----EDADDDKKRLLQIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQ 97

  Fly   122 EMRIKFADSPEKFMDSEVELHTVIQELKGVATVPDLYPILVDLHGLHSLLELLAHQNTDIAVAVV 186
            |:||||.|:|||||:||::|:.:|||:..|||:||||.:||:|..:.|||.||.|.|||:::|||
  Rat    98 ELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVV 162

  Fly   187 DLLQEVTDVDILGESQEGAESLIEALRKEQICALLVQNLERLNEQVKEEADGVHNTLAIVENLTE 251
            |||||:||:|.|.||:||||.||:||...|:.||||||||||:|.|:|||||||||||||||:.|
  Rat   163 DLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVREEADGVHNTLAIVENMAE 227

  Fly   252 IDSEFVKEAAEQGLLAWLLKRLRGKSPFDPNKLYCSEILSILIQTENENRLLLGSLDGVDVLLQQ 316
            ...|...|||:||||.||||||:.|.|||.|||||||:|:||:|..:|||.|||.|||:||||||
  Rat   228 FRPEMCTEAAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQ 292

  Fly   317 LAVYKRHDPASNEEQEYMQNLFNCLCSALMARENRDRFLSGEGLQLMNLMLREKKMSRNGSLKVL 381
            |:|:|||:|::.||||.|:|||:.|||.||...||:|||.|||||||||||||||:||:.:||||
  Rat   293 LSVFKRHNPSTAEEQEMMENLFDALCSCLMLSSNRERFLKGEGLQLMNLMLREKKISRSSALKVL 357

  Fly   382 DHAMAGQDGRDNCNKFVEILGLRTIFPLFMKTPKRNKQRLISADEHEEHVTSVIASMLRNCKGTH 446
            ||||.|.:|.|||:|||:|||||||||||||:|::.|:...:..||||||.|::||:|||.:|..
  Rat   358 DHAMIGPEGADNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRGQQ 422

  Fly   447 RQRMLAKFTENDHEKVDRLLELHLKYLAKVEAIDKEIDQQAKD-----PTIDEDEEAENNYIKRL 506
            |.|:|.||||||.||||||:|||.|||..::..||:|:.:..|     ..||.|.|.| .|::||
  Rat   423 RTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDIVRRGEIIDNDMEDE-FYLRRL 486

  Fly   507 TGGLFTLQRIDYILLEV-SATGDTVKQRVLQILNLRGASMKTIRSIMREYAGNLGDG-DTDWREQ 569
            ..|||.||.|.||:.|: :|....::|||.||||:||:|:|.:|.|::|||.|:||| ..::||.
  Rat   487 DAGLFILQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRET 551

  Fly   570 EQNHILSLVDRF 581
            ||..||.|::.|
  Rat   552 EQKRILGLLENF 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11964NP_649847.1 CTNNBL 87..183 CDD:285433 55/100 (55%)
ARM <155..251 CDD:237987 66/96 (69%)
Ctnnbl1NP_001020041.1 Nuclear localization signal. {ECO:0000250} 16..33 12/45 (27%)
CTNNBL 57..159 CDD:285433 55/102 (54%)
HEAT 1 79..129 32/50 (64%)
ARM <125..227 CDD:237987 69/102 (68%)
Nuclear export signal (NES). {ECO:0000250} 130..140 6/10 (60%)
HEAT 2 134..176 25/42 (60%)
ARM 1 178..228 37/50 (74%)
ARM 186..294 CDD:237987 76/108 (70%)
ARM 2 229..273 29/44 (66%)
ARM 3 274..323 34/49 (69%)
ARM 4 325..363 30/38 (79%)
ARM 5 364..417 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C305402521
eggNOG 1 0.900 E1_KOG2734
Hieranoid 1 1.000
Homologene 1 1.000 H12003
Inparanoid 1 1.050 614 1.000 Inparanoid score I846
OMA 1 1.010
OrthoDB 1 1.010 D387271at33208
OrthoFinder 1 1.000 FOG0005177
OrthoInspector 1 1.000 T1087788
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14978
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.