DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11964 and SPAC1952.06c

Sequence 1:NP_649847.1 Gene:CG11964 FlyBaseID:FBgn0037644 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_594808.1 Gene:SPAC1952.06c PomBaseID:SPAC1952.06c Length:564 Species:Schizosaccharomyces pombe

Alignment Length:589 Identity:175/590 (30%)
Similarity:303/590 (51%) Gaps:51/590 (9%)


  Fly     1 MDIGELLAFK-PEQTPKRPHDDEDDEFDLASSHGKRGGVDEKTKRMRRIAD--AKESAHYVKQSG 62
            ||:..:  || .|:|.|:.:.:|.|..:.|||.             ||:|:  :.|......:.|
pombe     1 MDVDSI--FKNTEETNKKRNPEEADSLEPASSR-------------RRLAEENSDEENEEFDEEG 50

  Fly    63 GATGGSGTSAFEFDPELTEEERLNILKYVENEEADGD--VLDEQSLKKLILVFEKRNLKNQEMRI 125
            |...|||         |.:.|: .:|.:::.:||..:  .|....||::::..||....|||:||
pombe    51 GRFFGSG---------LKKSEK-TVLDFLDEQEAQEEPASLTPTELKRMVVRLEKTINNNQELRI 105

  Fly   126 KFADSPEKFMDSEVELHTVIQELKGVATVPDLYPILVDLHGLHSLLELLAHQNTDIAVAVVDLLQ 190
            |::.||::|::||.:|...|:....::..|.|.||.:.|..:.:.|||:.|:|.||.:.|::||.
pombe   106 KYSTSPQRFIESEADLDLEIRSFNVLSEYPILIPIFLKLDCVSTFLELMNHENADITITVLELLI 170

  Fly   191 EVTDVDILGESQEGAESLIEALRKEQICALLVQNLERLNEQVKEEADGVHNTLAIVENLTEIDSE 255
            |:||.|:   ..:...||..:|....:..||...::|.:|..:|:..||:..|:::|||..:|:.
pombe   171 ELTDEDV---DPDALNSLFTSLIDSGLLPLLSNTIKRFDESNEEDRHGVYCVLSLMENLLSVDNS 232

  Fly   256 FVKEAAEQ-GLLAWLLKRLR-GKSPFDPNKLYCSEILSILIQTENENRLLLGSLDGVDVLLQQLA 318
            ......|. .|:.|||.|.. .::....|..|..|||:|::....|.:|.:.:|:|:|:||::::
pombe   233 ICSIIVENTTLVEWLLSRSSVDETSISTNLQYAVEILAIILANSKEAKLKVCNLNGIDLLLRRIS 297

  Fly   319 VYKRHDPASNEEQEYMQNLFNCLCSALMARENRDRFLSGEGLQLMNLMLREKKMSRNGSLKVLDH 383
            .|:..||....|:|.|:|:|:||||.:...:.:..||..||::|..|.::.|..||..::||||:
pombe   298 PYRLRDPTQGSEEEMMENVFDCLCSLVQETKGKSLFLKEEGIELCILNMKHKGKSRYSTIKVLDY 362

  Fly   384 AMAGQDGRDNCNKFVEILGLRTIFPLFMKTPKRNKQRLISADEHEEHVTSVIASMLRNCKG--TH 446
            .:.|......|.:|||..||:.||..|||         |||.:..||:.:::||:.|:...  ..
pombe   363 LLFGPLSTPYCIRFVEAGGLKYIFAAFMK---------ISAADTLEHILAILASLFRSLPADTVE 418

  Fly   447 RQRMLAKFTENDHEKVDRLLELHLKYLAKVEAIDKEIDQQAK-DPTIDEDEEAENNYIKRLTGGL 510
            |.|.|.||.|||.||:.||.:::.:...::    |.|||..| |.:.|.:|::...:::::..||
pombe   419 RVRFLRKFIENDFEKMKRLFKIYDRLRIQL----KGIDQSRKLDFSPDSEEKSTKWFLQQIDHGL 479

  Fly   511 FTLQRIDYILLEVSATGDTVKQRVLQILNLRGASMKTIRSIMREYAGNLGDGDTDWREQEQNHIL 575
            |..|....||..:........:::..:.:.....:..:...::.|..||.:...:..|.|.|...
pombe   480 FPFQSTVLILSWLCVENTVTLKKIKMLFSEASIPIDELTDALKNYHENLEEPTVESEEVEANDSY 544

  Fly   576 SLVD 579
            ..:|
pombe   545 YRID 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11964NP_649847.1 CTNNBL 87..183 CDD:285433 33/98 (34%)
ARM <155..251 CDD:237987 33/96 (34%)
SPAC1952.06cNP_594808.1 CTNNBL 63..163 CDD:285433 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I768
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005177
OrthoInspector 1 1.000 T1125286
orthoMCL 1 0.900 OOG5_129481
Panther 1 1.100 LDO PTHR14978
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1951
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.