DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pyd and tjp2

Sequence 1:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_002935643.2 Gene:tjp2 XenbaseID:XB-GENE-480467 Length:1209 Species:Xenopus tropicalis

Alignment Length:1350 Identity:371/1350 (27%)
Similarity:566/1350 (42%) Gaps:377/1350 (28%)


  Fly   220 NSNLLETASTHSSSQRRRFKKGDRTTWEYHTVAVTRVPGYGFGIAVSGGRDNPHFANGDPSIAVS 284
            |.||  :|...:||.       :...||..||.:.:....|||||||||:|||||.||:|||.:|
 Frog    25 NKNL--SAWLGASSM-------EELIWEQFTVTLQKDSKKGFGIAVSGGKDNPHFENGEPSIVIS 80

  Fly   285 DVLKGGPAEDRLQVNDRIISVNGVSLENVEYATAVQVLRDSGNTVQLVVK---------RRVP-- 338
            |||.||||:..||||||::.|||..::||.:|.|||.||..|.|..:|||         ||.|  
 Frog    81 DVLPGGPADGFLQVNDRVVMVNGTLMDNVFHAFAVQQLRKCGKTAVIVVKRPRKVQVTARRSPSP 145

  Fly   339 -LNP-----INAAGAVQHQHSHSLSSVGLMANGSG------------------------------ 367
             |:|     ::..|..:|:.::|..|.....:|:|                              
 Frog   146 ELDPRDIDAVDDDGPFEHRSAYSGYSERSWHSGNGHHSRESSPDRGYSKDQERGRSYDRDQDWVR 210

  Fly   368 ----------------------------------------------------------------G 368
                                                                            .
 Frog   211 GRSRERDLDDEREYRRERSRGRSLDRDQSEERRYKRDHKKSVDREESFERSYSGDYSPDRGNGRR 275

  Fly   369 VAP-------TPI--------TSLSQPNSLNSSLVQNASSGQPIKVTLTKGGKKDDYGVVLGCRL 418
            :||       .|:        :....|.....|...:....:||.|.|:|....::||:.||.::
 Frog   276 LAPDYRSEREMPVNRARDRLQSHSPSPEPHRKSAAAHKGHDKPISVLLSKNKPSEEYGLRLGSQI 340

  Fly   419 FVKEISSKAREQLNANGYSLQEGDIITRIHNTNCGDTMSLKEAKKIIDGCKERLNLVVLRDITNQ 483
            |:||:::....:.:.|   |.||||:.:|:.| ..:.|||.:|:|:|:..:.:|.|:|.|| .:|
 Frog   341 FIKEMTNTGLARRDGN---LHEGDIVLKINGT-VTENMSLTDARKLIERSRGKLQLLVQRD-ASQ 400

  Fly   484 TAVSQLNLNNSASHQASGNIYATHQPQVSGCSSSNNNLEDPYLPGGASYSSQNLYVQPPTRTSNG 548
            |.::...|::|.|.  .|:|.....      :.||:.|||..|....|:||.....:..:...:.
 Frog   401 TLINIPALDDSDSD--IGDISDIES------NRSNSPLEDSRLQHSDSHSSTEKLKEKSSSKEDP 457

  Fly   549 PNINGNGLNDEKSNLTPRGRSRGPIMDGVSLQQLDRPVTPTRGRSAAIDEPPRPPPPRGSSGGAA 613
            ||                           .|.::....||.:    .:.....|||...||    
 Frog   458 PN---------------------------RLAKMGAMPTPFK----VVGTTETPPPVSVSS---- 487

  Fly   614 QEDFYSSRRQLYEERQSAE---------------------------PRFISFQKEGSVGIRLTGG 651
                 .|...:.||.|..|                           .:.|.|.|..:||:||.||
 Frog   488 -----VSSENIKEEEQEEEAPVELPVAAPKVFLQPSPEDEEIYGPGTKMIKFVKGDTVGMRLAGG 547

  Fly   652 NEAGIFVTAVQPGSPASLQGLMPGDKILKVNDMDMNGVTREEAVLFLLSLQ--DRIDLIVQYCKE 714
            |:.|||:..||.||.|..|||..||::||||..|..|:.||||||:||.:.  :.:.::.|...:
 Frog   548 NDVGIFIAGVQEGSAAEQQGLQEGDQLLKVNTQDFRGIAREEAVLYLLDVPKGEEVIILTQSRSD 612

  Fly   715 EYDEVVTNQRGDSFHIKTHFHCDNPSKGEMAFKAGDVFRVIDTLHNGVVGSWQVLKIGRGHQEMQ 779
            .|..::...|||||.|:|||..|..:...::|..|::|||:|||::|.:|:|..::|.   .|::
 Frog   613 VYKNILACGRGDSFFIRTHFEYDKEAPQFLSFTRGEIFRVVDTLYDGKLGNWLSVRIA---NELE 674

  Fly   780 RGVIPNKSRAEELATAQFNATKKEMNANESRGNFFRRRRSTHRRSKSLSRENWDDVVFSDSIS-K 843
            :|:||:|||||:||:.|.    .:..|...|.:|: :.|.....:|..:|::.||:....::| |
 Frog   675 KGLIPSKSRAEQLASVQL----AQRGAAGDRADFW-KNRGQRSGAKKNARKSRDDLTTVSAVSTK 734

  Fly   844 FPAYERVVLRHPGFVRPVVLFGPVSDLARERLAKDFPDKFSTPLQDDDKSAATSGKCRIVRLSNI 908
            |||||||:||..||.||||:|||::|:|.|:||.|.|..:.. .:.:.|.|.:.....:|||:.:
 Frog   735 FPAYERVLLREAGFKRPVVVFGPIADVAMEKLATDMPSLYQI-AKTEPKDAGSDKSSGVVRLNTV 798

  Fly   909 RDVMDRGKHALLDITPNAVDRLNYAQFYPVVIFLKTDSKHVIKQLRHGLPKAAHKSSKKLLEQCQ 973
            |.::::.||||||:||.|||.|||.|::|:|:|...|:|..:|.:|..|...::||||||.:|..
 Frog   799 RMIIEQDKHALLDVTPKAVDLLNYTQWFPIVVFFNPDNKQGVKTMRQRLCPTSNKSSKKLYDQAA 863

  Fly   974 KLERVWSHIFSTQIAL-SDEESWYRKLRDSIDLQQSGAVWMSESKPVESLSDD----FLFPMTTS 1033
            ||::..:|:.:..|.| |..:|||..::|.|..||:.|||:||.|......:|    :|..|...
 Frog   864 KLKKTCAHLITATINLNSANDSWYGSIKDVIREQQTQAVWVSEGKADGGEEEDDRMSYLTAMGAD 928

  Fly  1034 RLSYASSPESDLELSPGPSASLSLGNLPQLVKASSDPSIATNQDNLDRDRDIIGEGLPPPYTVPY 1098
            .||..|...||.|.:.|...:.:...|.:||......|..:......|..:.|.:.:|.|     
 Frog   929 YLSCDSRLVSDFEDTDGEGGAYTDNELDELVDDPLPVSAISRSSEPVRQEETIAKPVPEP----- 988

  Fly  1099 DHAVPANPNRRQTMDSSKYSIYGTNVPPQQQQPGVGGDTAAVRPQSLYGINAPDLPPRIDRQSKP 1163
                     |.|...:....:.....||...:|.                     ||::..|||.
 Frog   989 ---------RGQMKKAGSREMLRDPSPPPTFKPE---------------------PPKVKAQSKD 1023

  Fly  1164 G--DIPLNTS--------GSSSRNGTLGR-----SAQERLF-GKAVVQDDV-------------- 1198
            .  |:|.::.        |||..:|...:     :|.:.:| ||.:::..|              
 Frog  1024 DIYDLPRSSEANRSSSSVGSSEISGGSAKAIPPPTAAKPVFPGKPILKAPVTVPSPGTEEVAPIK 1088

  Fly  1199 QAEYITRNALVGSGAAETLD------RQQQQQQQTHASLERQARLNAQLKANGVGAGGGGASTYD 1257
            :...:.::.|......|.:|      |.|:.|:..:|.||...:|                    
 Frog  1089 EEANVPKSVLGKVKIFEKMDFSARAQRLQELQEAQNARLELAQKL-------------------- 1133

  Fly  1258 SVSSYDSYNNTQMAMQNLGRLGPNAPDDLKSVP-----NANGRPLPPTGQSHEYGRTPHDHRSFG 1317
                                      .|:.:||     |...||.|.:.:..|            
 Frog  1134 --------------------------PDIYAVPVKPQKNEQNRPQPTSSRPPE------------ 1160

  Fly  1318 GPNDLNRQSSPGRPHYHDMNASRNIDPRNGTPQR----PSNLGLESSPRK 1363
                  .|..|.|. |.|..||...|......:|    .|..|..|.|.|
 Frog  1161 ------PQKPPSRT-YQDNRASYGSDEEEEEYRRQLADQSKRGYYSQPSK 1203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492 50/85 (59%)
PDZ_signaling 396..477 CDD:238492 29/81 (36%)
PDZ_signaling 633..710 CDD:238492 37/79 (47%)
SH3_ZO 729..790 CDD:212793 25/61 (41%)
GuKc 831..1007 CDD:214504 77/178 (43%)
ZU5 2263..2351 CDD:279170
tjp2XP_002935643.2 PDZ_signaling 45..130 CDD:238492 50/85 (59%)
PDZ_signaling 318..395 CDD:238492 29/81 (36%)
PDZ 531..603 CDD:278991 37/72 (51%)
SH3_ZO-2 623..685 CDD:212960 29/65 (45%)
GuKc 719..898 CDD:214504 78/180 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115497520
eggNOG 1 0.900 E1_KOG3580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1175136at2759
OrthoFinder 1 1.000 FOG0001893
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.