DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pyd and tjp1b

Sequence 1:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_021326398.1 Gene:tjp1b ZFINID:ZDB-GENE-070925-1 Length:2043 Species:Danio rerio

Alignment Length:2404 Identity:624/2405 (26%)
Similarity:929/2405 (39%) Gaps:775/2405 (32%)


  Fly   189 ERERGGDRDRPYIRNVDDLL---QALGKRDGGDNNSNLLETASTHSSSQRRRFKKGDRTTWEYHT 250
            :...|....:|.:|.:...:   ::|...|..|:||..::                :...||.||
Zfish   218 DESEGSGHGKPSLRRIKGRIHRSKSLDSIDLLDSNSAAMD----------------ETVIWEQHT 266

  Fly   251 VAVTRVPGYGFGIAVSGGRDNPHFANGDPSIAVSDVLKGGPAEDRLQVNDRIISVNGVSLENVEY 315
            |.:.|.||:|||||:|||||||||.:|:.||.:||||||||||..||.|||::.||.||::||::
Zfish   267 VTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGLLQENDRVVMVNAVSMDNVDH 331

  Fly   316 ATAVQVLRDSGNTVQLVV--KRRVPLNPINAAGAVQHQHSH---------------------SLS 357
            |.|||.||.||...::.:  ||:|.: |....|..:....|                     |..
Zfish   332 AYAVQQLRKSGKNAKITIRRKRKVQI-PSGRPGERETMSEHDEDDDSYEDEIYESRSARSGPSAY 395

  Fly   358 SVGLMANGSGGVA------------------------PTPITSLSQPNSLNSSLVQNASSGQPIK 398
            |.|....|.||.:                        ...::..|..:|::|:|     ..:|.|
Zfish   396 SGGGGGGGGGGASGRRSGRGDRLSGRRERDRERSGSRERSLSPRSDRHSVSSNL-----PPRPAK 455

  Fly   399 VTLTKGGKKD--------------DYGVVLGCRLFVKEISSKAREQLNANGYSLQEGDIITRIHN 449
            |||.|..|.:              :||:.|...:|||:||.   |.|.|...::||||::.:|:.
Zfish   456 VTLVKSRKNEACMASGSSQKVTSAEYGLRLASHIFVKDISP---ESLAARDGNIQEGDVVLKING 517

  Fly   450 TNCGDTMSLKEAKKIIDGCKERLNLVVLRDITNQTAVSQLNLNNS-----ASHQ---------AS 500
            | ..:.:||.:|||:|:..|.:|.:||.|| ...|.::..:|::|     ||.:         ||
Zfish   518 T-VTENLSLIDAKKLIERSKGKLKMVVQRD-ERATLLNIPDLDDSIPSANASDRDDISDIHSVAS 580

  Fly   501 GNIYATHQPQVSGCSSSNNNLEDPYLPGGASYSSQNLYVQPPTRTSNGPNINGNGLNDEKSNLTP 565
            .:...:|..:.|..|.|.:...:|     :.:|..:     |.:.|||   ...|...:::....
Zfish   581 DHSNRSHDRKRSSRSRSPDRRSEP-----SDHSRHS-----PPQISNG---RATGPTAQRTRPVH 632

  Fly   566 RGRSR------GPIMDGVSLQQLDRPVTPTRGRSAAIDEPPRP-PPPRGSSGGAAQEDFYSSRR- 622
            |.|..      ||:.....:.: :.|...:..|......||.| |.|..:..|....|...|.. 
Zfish   633 RSRDEDRISKAGPLPLPAKMVE-EMPKEQSAARETEKQLPPLPEPKPVYAQPGQPDVDLPVSPAD 696

  Fly   623 ----QLYEERQSAEP--RFISFQKEGSVGIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDKILKV 681
                .:..:.....|  :.:.|:|..|||:||.|||:.||||..|...|||:.:||..||:||:|
Zfish   697 APVPSVTHDDSILRPSMKLVKFKKGESVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRV 761

  Fly   682 NDMDMNGVTREEAVLFLLSLQ--DRIDLIVQYCKEEYDEVVTNQRGDSFHIKTHFHCDNPSKGEM 744
            |::|...:.|||||||||.|.  :.:.::.|..|:.|..:|.:..||||:|:|||..:..|...:
Zfish   762 NNVDFANIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGL 826

  Fly   745 AFKAGDVFRVIDTLHNGVVGSWQVLKIGRGHQEMQRGVIPNKSRAEELATAQFNATKKEMNANES 809
            :|..|:||||:|||:||.:|||..::||:.|||::||:||||:|||:|::.|:...|   .....
Zfish   827 SFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHQEVERGIIPNKNRAEQLSSVQYTLPK---TPGGD 888

  Fly   810 RGNFFRRRRSTHRRSKSLSRENWDDVVFSDSISKFPAYERVVLRHPGFVRPVVLFGPVSDLARER 874
            |.:|:|.|..  |.||...|::.:|:......:|||||||||||..||:||||:|||::|:|||:
Zfish   889 RADFWRFRGL--RSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVVIFGPIADVAREK 951

  Fly   875 LAKDFPDKF----STPLQDDDKSAATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNYAQF 935
            |:::..|.|    |.| :|......:||   |:||..|:.::||.|||:|||||||||||||||:
Zfish   952 LSREETDLFELAKSEP-RDAGTDQRSSG---IIRLHTIKQIIDRDKHAVLDITPNAVDRLNYAQW 1012

  Fly   936 YPVVIFLKTDSKHVIKQLRHGLPKAAHKSSKKLLEQCQKLERVWSHIFSTQIALSD-EESWYRKL 999
            ||:|:||..|||..:|.:|..|...:.||::||.|:..||.:...|:|:|.|.|:: .:.||..|
Zfish  1013 YPIVVFLNPDSKQGVKNMRTRLCPESRKSARKLYERALKLRKNNHHLFTTTINLNNMNDGWYGAL 1077

  Fly  1000 RDSIDLQQSGAVWMSESKPVESLSDDFLFPMTTSRLSYASSPES----------------DLELS 1048
            ::||..||:..||:||.|...:..||  ..:...||||.|:|.|                |.:..
Zfish  1078 KESIQQQQNQLVWVSEGKADGAPDDD--LDIHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTE 1140

  Fly  1049 PGPSASLSLG-NLPQLVKASSDPSIATNQDNLDRDRDIIGEGLPPPYTVPYDHAVPANPNRRQTM 1112
            .|......|. .:...|...|:|:|..:.:.:..|..:|.:....|   .|.|||| .|.....:
Zfish  1141 GGAYTDQELDETMNDEVGLPSEPAITRSSEPVREDPPVIQDAAGYP---SYQHAVP-QPEAVSRI 1201

  Fly  1113 DSSKYSIYGTNVPPQQQQPGVGG---DTAAVRP-QSLYGINAPDLPPRIDRQSKPGDIPLNTSGS 1173
            |.:.:.:   ..|.||.:..:..   .:|||:| .:|.|.| |:.||                  
Zfish  1202 DPAGFKM---AAPQQQAEAALASPPPPSAAVQPTATLAGTN-PEEPP------------------ 1244

  Fly  1174 SSRNGTLGRSAQERLFGKAVVQDDVQAEYITRNALVGSGAAETLDRQQQQQQQTHASLERQARLN 1238
                                                |:..|::|                     
Zfish  1245 ------------------------------------GTPQADSL--------------------- 1252

  Fly  1239 AQLKANGVGAGGGGASTYDSVSSYDSYNNTQMAMQNLGRLGPNAPDDLKSVPNANGRPLPPTGQ- 1302
                                                      |:|     ||..:.:|.|...| 
Zfish  1253 ------------------------------------------NSP-----VPVPDPQPEPELAQP 1270

  Fly  1303 -SHEYGRTPHDHRSFGGPNDLNRQSSPGRPHYHDMNASRNIDPRNGTPQRPSNLGLESSPRKPLV 1366
             :|:    ||             ||.|..|           ||:.                    
Zfish  1271 PTHD----PH-------------QSLPPGP-----------DPKM-------------------- 1287

  Fly  1367 ETKTDYGK--YSRNNSVTQADYTKLPKTAPHGVVPPPNVSNGQGQMNGSGTPSS---------NG 1420
                 |.|  ||.:.          |....|||.|||    .|.|....|.|:|         ..
Zfish  1288 -----YKKDLYSMDE----------PVRVTHGVKPPP----PQQQQQPLGPPTSLSYSHQPVYQD 1333

  Fly  1421 SGPFKPV--PP----------PKPKNYRPPVQSGGSSGSGGTTPWENGDSGSPRSPNGFYYPPTP 1473
            ..|::..  ||          |||.||.|.:.            ::|      |.|:  |....|
Zfish  1334 QQPYRQYDHPPYGYDGGGYAQPKPHNYDPHLH------------YDN------RVPH--YNEQWP 1378

  Fly  1474 SHHHYGQQATPGSPSNGHMQPPP----PQQQQPTYGGSNGNYGQAPPPQSYPQANGYNGNGHHYN 1534
            ::....||.|  ||     ||||    ||..||          ..|||..|...:.|..      
Zfish  1379 TYDQQQQQQT--SP-----QPPPASGFPQGHQP----------PPPPPMGYEPRSPYED------ 1420

  Fly  1535 GGSGTGPYIAPHRGMPPPIGNLPPHTPERHALDLAGSREQRGSAFELYRKPQIGATAGHHHNMSE 1599
                     .|:|...||.......:|                             .|:.|....
Zfish  1421 ---------GPNRDFSPPQSQYDGVSP-----------------------------MGYDHRPRH 1447

  Fly  1600 MEPYDERYDDYYNMPPPAAHPSQGHHMQRSRSAPRYPHERPPHAQDPNYYGHYGTSRGHSQPRQQ 1664
            .:|...||::....|||.::.:            |.|.|..|||...|      |.|....|:|.
Zfish  1448 PKPAPVRYEEPPPPPPPVSYDA------------RSPFEPEPHAFPGN------THRSPDPPKQY 1494

  Fly  1665 YSQHHQQQYYDDHGLEMGPPPLPPHKKKKSVLKSPLVALKNALLKSTRPLRRMNSMVEPERKPKG 1729
            |.....:..|:         |.||::           ..|:..:.|..|:        |..||  
Zfish  1495 YGDAAMRPLYN---------PGPPNR-----------VYKHEPVNSEPPV--------PPPKP-- 1529

  Fly  1730 LRRQQSMLERGVQRPYYPDEYPTYPAGFEERAHGGQGMMQPHSQDAYYQRGGHYAPQQQEMMNST 1794
                :|:|..| :.|:.....|..|              .|...|.........|.:.|.::|  
Zfish  1530 ----ESVLSPG-EPPHSAASKPLPP--------------PPRDDDDDDDDDDDPAMKPQSVLN-- 1573

  Fly  1795 YQNLEGEDIYGNIGNTVPRMPHHQDNGYGYDQYDLYANRACIDLERRQAEAAAASGGRNGRRIVR 1859
                                           :..::.|:..:.::|.: :|...:|.|       
Zfish  1574 -------------------------------RVKMFENKRSVSVDRAK-DAPDVTGIR------- 1599

  Fly  1860 RHSTTTADRGGNPGP---------------------PRRPMISPG--------YEQDPQEIYQTR 1895
              .|........|||                     |::|....|        |:.|..|.|..:
Zfish  1600 --PTDLPKPASTPGPVLKANSLSNLEQDKPSYRAPEPQKPQTRVGDDVVRSNHYDPDDDEEYYRK 1662

  Fly  1896 NGAYMLPDQRRAPSSEVMTRRRFYPGAANEQTEEEPLYQSRREMQREMQRNHLYQ-SKREMQERI 1959
            ..::.   .||:..|:||..    |.|...:..|.|         :..|....|. ::.|..|::
Zfish  1663 QLSFF---DRRSFDSKVMNP----PSAGVNRFHEPP---------KPPQTQIAYPFARTESVEKV 1711

  Fly  1960 SQGKRDMEREFSPQSSSSQSEASNSEAIYQSRREAKESALKTRSQLRDQIYQTRREALDSMAEPI 2024
            |    .:::.:.|....:.|.|..|:.                               ..:|.|.
Zfish  1712 S----PVDKRYEPLPPVNPSPAPYSQN-------------------------------TPVAPPT 1741

  Fly  2025 YVSKRGMGRPAPIYETREESILQSRENETDEKKEKECKTEQIQVEINAQPEEQIEDSTLSRSDLQ 2089
            .:.|                                    ...:|:|:.|:.  ..|..::.|| 
Zfish  1742 SLPK------------------------------------LTNIEVNSLPDP--HSSPKAKPDL- 1767

  Fly  2090 KSSDTVIENPARAPLVQDEVDDDEEEEVQDQRDPAESSADQTEQP-----TAIENNLHNEGMVEQ 2149
                    :..|||        ..:|.:|....|.:|:.:..:.|     .....|.:.......
Zfish  1768 --------SALRAP--------TRDEPIQSSYLPPKSTINGMDAPPKTLGVPTSYNRYVPKPYTS 1816

  Fly  2150 SQNDSDDVFEAADKVSPLAPPPAPVQPPTPRSGRAPFHISNILK-RTAPPPSSPIGDSCTSIETQ 2213
            |....:..||:......|.|.....:|          .::|.|| :.:|.|.    |:.:.::|.
Zfish  1817 SARPFERKFESPKFNHNLLPNDTQSKP----------SVNNNLKPQISPQPQ----DTDSGVDTF 1867

  Fly  2214 YTSQASLPVGPPNATSTPFSSSMSLPIAGPVNNQPSA-------NGRFPTLPREPSTSRGFFDSN 2271
            ..:..:.|....|..:       ::|.|.||:  |||       .|....     :|:||.|:.|
Zfish  1868 TRTMDNRPKYQHNNIN-------AIPKAVPVS--PSALDDDEEDEGHTVV-----ATARGIFNCN 1918

  Fly  2272 GGTLADKLWHVSLQIPPGAIPAGVRQEIYFTVSDPRMGQAVGGPPLDMENGETMLSPLVMCGPQG 2336
            ||.|:.....||:.||.||||..|.|||||.|.  |....:  ||||.|.|||:|||||||||.|
Zfish  1919 GGVLSSIETGVSIIIPQGAIPDSVEQEIYFKVC--RDNSIL--PPLDKEKGETLLSPLVMCGPHG 1979

  Fly  2337 LEFLVPVTLNIPHCAGRTA-SLGLALKATDSEKNLHTEWDNIDLPSN----AAAHTVSVKVDHF 2395
            |:||.||.|.:||||..|. ....|||::||.......|.|..||.:    ..|:.|||.:|||
Zfish  1980 LKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKCWQNKCLPGDPNYLVGANCVSVLIDHF 2043

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492 52/87 (60%)
PDZ_signaling 396..477 CDD:238492 34/95 (36%)
PDZ_signaling 633..710 CDD:238492 38/81 (47%)
SH3_ZO 729..790 CDD:212793 32/61 (52%)
GuKc 831..1007 CDD:214504 86/181 (48%)
ZU5 2263..2351 CDD:279170 51/88 (58%)
tjp1bXP_021326398.1 CARD 59..132 CDD:260018
PDZ_signaling 265..350 CDD:238492 52/85 (61%)
PDZ 477..546 CDD:214570 28/73 (38%)
Atrophin-1 <606..703 CDD:331285 20/106 (19%)
PDZ 720..792 CDD:278991 36/72 (50%)
SH3_ZO-1 808..872 CDD:212959 35/64 (55%)
GuKc 906..1085 CDD:214504 87/183 (48%)
Atrophin-1 <1171..1906 CDD:331285 211/1252 (17%)
ZU5 1910..2009 CDD:307095 56/103 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115520026
eggNOG 1 0.900 E1_KOG3580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175136at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129845
Panther 1 1.100 O PTHR13865
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.