DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pyd and Dlg5

Sequence 1:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:NP_609505.1 Gene:Dlg5 FlyBaseID:FBgn0032363 Length:1916 Species:Drosophila melanogaster

Alignment Length:1268 Identity:275/1269 (22%)
Similarity:451/1269 (36%) Gaps:396/1269 (31%)


  Fly    14 PPKSNVYNPLVRYRPTAYVRNGIIGGA--------EGPGSSGVYQI-----ADRVYTTSKMFLRD 65
            ||:.:        :|.|::| |..|||        ..|.||||..:     .:.:..||      
  Fly   784 PPQMS--------KPLAHIR-GSNGGAIKTHPNRNSNPVSSGVSALFPPGPPNGMPNTS------ 833

  Fly    66 GYMYPRQPGQTMDPRFPLELHEFPQQ----FGATG-------------------LQLVSAPKVHI 107
               ||..|..::......|:::.|.|    .||..                   |.|...|    
  Fly   834 ---YPTHPRHSLYGVTAEEINQKPIQRAPLMGANARVKMPSQERYGTRPHSNHRLSLNITP---- 891

  Fly   108 AGEYLASEQQQQQQQQQQQHQQ-------VQEQQQLGRRKAAAAAEINLANQVY----------- 154
            :|::...:...||.|||..:..       |.....:|....||........|||           
  Fly   892 SGDFYQPKTSGQQAQQQVMNASSTSAGFGVGSGSMVGGTGPAAGEFPVRKQQVYDVFHPPPLPKN 956

  Fly   155 ------WLGKQKTR--------------SRSRSNSV----------------------------- 170
                  ::....||              |....||:                             
  Fly   957 SSGSNMFMPLHPTRGSHPPPVGQPPDVVSLKSQNSIESILSAKSPAISEYGMYAKRHVPQAVRHV 1021

  Fly   171 -----GNRSITSCMGGGGGGGEKERERGGDRDRPYIRNVDDLLQALGKRDGGDNNSNLLETASTH 230
                 .:.||.|.:.||.||..:.....|:|.       ..|....|....|:..|:.|...|..
  Fly  1022 PKYPSDSESIGSGVHGGYGGFLQSNHMPGNRH-------TQLFPTFGPGGRGNRRSSPLTLPSPP 1079

  Fly   231 SSSQRRRF--------KKGDRTTWEYHTVAVTRVPG--------------YGFGIAVSGGRDNPH 273
            ...|.::.        ..|..|..:||....|:...              ||.|:.:     .|:
  Fly  1080 PQQQLQQLPAATAPHDSVGIPTDLDYHPHHHTQTNAMPHPHPHPHAPYLDYGHGLGI-----GPY 1139

  Fly   274 FANGDPSIAVSDVLKGGPAEDRLQVNDRIISVNGVSLENVEYATAVQVLRDSGNTVQLVVKRRVP 338
            ...|.....|...:..|....|.:.|.|:                                 |:|
  Fly  1140 MGVGGGVSGVGGAIYEGGTFPRKKDNQRL---------------------------------RIP 1171

  Fly   339 LNPI----------NAAGAVQHQHSHSLSSV--GLMANGSGGVAPTPITSLSQPNSLNSSLVQNA 391
            .||.          |::|::.|.:..|...|  |.|:..|...||..:.|.|..||..:::....
  Fly  1172 SNPSVASKSSSMVKNSSGSIDHHYVTSTGPVSGGSMSASSSDRAPMSLMSSSIHNSYGANIAGGN 1236

  Fly   392 SSGQPIKV--------------------TLTKGG--------------------------KKD-D 409
            .:|..|.|                    .|:.||                          |:| .
  Fly  1237 GTGSSIGVGGGGGGGSGRGSPMPQVHVEVLSHGGGGSGKRNSNVPADFLCPGDLRRVTIDKRDKS 1301

  Fly   410 YGVVLGCR-----LFVKEISSKAREQLNANGYSLQEGDIITRIHNTNCGDTM---SLKEAKKIID 466
            .|:.:.|.     :||..::.|:    .|....||.||.:..:    ||..|   :.:.|..::.
  Fly  1302 LGITIQCNNNGGGIFVSTVADKS----TAMRAGLQVGDQLLEV----CGINMRAATQEIAANVLR 1358

  Fly   467 GCKERLNLVVLRDITNQTAVSQLNLNN--SASHQASGNIYATHQPQVSGCSSSNNNLEDPYLPGG 529
            .|.:...::|           |.|...  |..::.:.|:........||..:..|:...|     
  Fly  1359 QCGDSFTMLV-----------QYNPEKFPSIEYEGAHNLEPESPINHSGSPTPRNSPRPP----- 1407

  Fly   530 ASYSSQNLYVQ---PPTRTSNGPNINGNGLNDEKSNLTPRGRSRGPIMDGVSLQQLDRP------ 585
            |..|...|.:|   |.||..:...::...:.|:....:...:|      .:|..| |.|      
  Fly  1408 ARNSLFPLPMQPQAPSTRPGSRAPLSHQSIKDQSFTDSLENQS------DISSSQ-DMPSSAATT 1465

  Fly   586 -VTPTRGRSAAIDEPPRP--PPPRGSSGGAAQEDFYSSRRQLYEERQSAEP-RFIS--FQKEGSV 644
             .|.....|...||.|:|  |||..|                    ..||. |:::  ..|..::
  Fly  1466 TTTTASATSTVYDEEPKPSLPPPPAS--------------------VPAETLRYVTLHMDKSKNL 1510

  Fly   645 GIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDKILKVNDMDMNGVTREEAVLFLLSLQDRIDLIV 709
            ||:|.|||:.||:|..|..|||:...|:..||:||:.|.:|::|||.|:|...:..|.|.:.::|
  Fly  1511 GIKLFGGNKVGIYVHDVAVGSPSDHAGIRKGDQILEYNGVDLSGVTAEQAANEISKLTDTVTMLV 1575

  Fly   710 QYCKEEYDEVVTNQRGDSFHIKTHF-HCDNPSKGEMAFKAGDVFRVIDTLHNGVVGSWQVLKI-G 772
            |. |....:.:.::.||||:|:..| .....::.::.|...:|..|.:|:.||..|.|:..|: .
  Fly  1576 QN-KLHTLKQIKDEPGDSFYIRVGFDRTGELNEDDLRFVKDEVLYVDNTVFNGTFGLWRAWKLDA 1639

  Fly   773 RGHQEMQRGVIPNKSRAEE-----------LATAQFNATKKEMNANESRGNFFRRRRSTHRRSKS 826
            .||:: :.|:||::.:.||           ..||:..:|       .:|.:||||:::    .:|
  Fly  1640 MGHRK-ECGIIPSQMKVEEELRSGEVVDCDTGTARRGST-------SARRSFFRRKKN----QRS 1692

  Fly   827 LSRENWDDVVFSDS-ISKFP------------AYERVVLRHPGFVRPVVLFGPVSDLARERLAKD 878
            .||::.:...||:: :|.||            :|:||.|......|||::.||:|:....||..|
  Fly  1693 SSRDSTEIASFSNTQLSFFPDLGLLNDDGGALSYQRVELLDSPIRRPVLIIGPLSECLMVRLTID 1757

  Fly   879 FPDKF---STPLQDDDKSAATSG----------------KCRIVRLSNIRDVMDRGKHALLDITP 924
            |.:.|   .....|..:.|...|                :|..|...:.....|| :|.:||::.
  Fly  1758 FSNLFKLCEVTAMDCSQEAMEEGLKENIFVDYRRRGNKFECTTVEAISNACKNDR-RHCILDVSI 1821

  Fly   925 NAVDRLNYAQFYPVVIFLKTDSKHVIKQLR-HGLPKAAHKSSKKLLEQCQKLERVWSHIFSTQIA 988
            :||:||...|.||:|:.|:..|...|:.:| .|..|.:.|::|::.|:..|||..:....|..|.
  Fly  1822 SAVERLQRLQIYPIVLLLRFKSAKQIRDIRDFGTDKISAKAAKEMYERAMKLETDYKQYISAVIP 1886

  Fly   989 LSDEESWYRKLRDSIDLQQSGAVWMSESKPVES 1021
            ....:....:::|::|.:|...:|:    ||.|
  Fly  1887 GVSIKHMCTQIKDAVDKEQDKLLWV----PVSS 1915

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492 12/99 (12%)
PDZ_signaling 396..477 CDD:238492 23/136 (17%)
PDZ_signaling 633..710 CDD:238492 30/80 (38%)
SH3_ZO 729..790 CDD:212793 16/63 (25%)
GuKc 831..1007 CDD:214504 54/209 (26%)
ZU5 2263..2351 CDD:279170
Dlg5NP_609505.1 AAA_23 <165..333 CDD:290211
CENP-F_leu_zip 229..360 CDD:287450
DUF1090 <326..408 CDD:284007
PDZ_signaling 439..516 CDD:238492
PDZ_signaling 533..592 CDD:238492
PDZ_signaling 1290..1369 CDD:238492 18/98 (18%)
PDZ_signaling 1497..1576 CDD:238492 30/79 (38%)
SH3_DLG5 1594..1657 CDD:212794 17/64 (27%)
Guanylate_kin 1737..1904 CDD:279019 45/168 (27%)
NK <1773..1905 CDD:302627 33/133 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115467623
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.