DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pyd and Tjp3

Sequence 1:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:NP_001269025.1 Gene:Tjp3 MGIID:1351650 Length:913 Species:Mus musculus

Alignment Length:963 Identity:316/964 (33%)
Similarity:474/964 (49%) Gaps:164/964 (17%)


  Fly   237 RFKKGDR---TTWEYHTVAVTRVPGYGFGIAVSGGRDNPHFANGDPSIAVSDVLKGGPAEDRLQV 298
            ||:..|.   |.||.||..:.:.|..|||||||||.|.   |:|  |:.||||:.|||||.||:.
Mouse     4 RFQVADMEELTIWEQHTATLYKDPRRGFGIAVSGGHDR---ASG--SVVVSDVVPGGPAEGRLRT 63

  Fly   299 NDRIISVNGVSLENVEYATAVQVLRDSGNTVQLVVK--RRVPLNPINAAGAVQHQHS------HS 355
            .|.|:.|||||:|||..|.|:|:|:....|..:.||  |||.|....|:.|..||.|      |.
Mouse    64 GDHIVMVNGVSVENVTSAFAIQILKTCTKTANVTVKRPRRVQLPATKASPASGHQLSDQEEADHG 128

  Fly   356 LSSVGLMANGS----------------------------GGVAPTPITSLSQPNSLN-----SSL 387
            ....|..::||                            ||         |:.|.|:     ..|
Mouse   129 RGYEGDSSSGSGRSWGERSRRSRAGRRGRVGSHGRRSSGGG---------SEANGLDLVSGYKRL 184

  Fly   388 VQNASSGQPIKVTLTKGGKKDDYGVVLGCRLFVKEISSKAREQLNANGYSLQEGDIITRIHNTNC 452
            .:.....:|:|..|.|....:::||.||.::|:|.|:...   |.|..:.|||||:|.:|:..:.
Mouse   185 PKQDVLMRPLKSVLVKRRNSEEFGVKLGSQIFIKHITESG---LAARNHGLQEGDLILQINGVSS 246

  Fly   453 GDTMSLKEAKKIIDGCKERLNLVVLRDITNQTAVSQLNLNNSASHQASGNIYATHQPQVSGCSSS 517
            .: :||.:.:::|:..:..|.|:||||                    ||.......|.||  .|.
Mouse   247 AN-LSLSDTRRLIEKSEGELTLLVLRD--------------------SGQFLVNIPPAVS--DSD 288

  Fly   518 NNNLEDPYLPGGASYSSQNLYVQPPTRTSNGPNINGNGLNDEKSNL---TPRGRSRGPIMDGVSL 579
            ::.:||      .|..:..|...||:.....|........|.:::.   ||:.|.|         
Mouse   289 SSLMED------ISDLTSELSQAPPSHVPPPPLKGQRSPEDSQTDSPVETPQPRRR--------- 338

  Fly   580 QQLDRPVTPTRGRSAAIDEPPRPPPPRGSSGGAAQEDFY--SSRRQLYEERQSAEPRFISFQKEG 642
               :|.|     .|.||.||..|        |.::.|.|  .||:.|.:...|.:.|.:||.|..
Mouse   339 ---ERSV-----NSRAIAEPESP--------GESRYDIYRVPSRQSLEDRGYSPDTRVVSFPKGA 387

  Fly   643 SVGIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDKILKVNDMDMNGVTREEAVLFLLSLQ--DRI 705
            |:|:||.|||:.||||:.||.||||..||:..||:||:||.|....:||||||.|||.|.  :.:
Mouse   388 SIGLRLAGGNDVGIFVSGVQAGSPADGQGIQEGDEILQVNGMPFRNLTREEAVQFLLGLPPGEDM 452

  Fly   706 DLIVQYCKEEYDEVVTNQRGDSFHIKTHFHCD-NPSKGEMAFKAGDVFRVIDTL---------HN 760
            :|:.|..::.:.::|.::.||||:|:|||..: :|..| :.|..||||.|:|||         |:
Mouse   453 ELVTQSKQDIFKKMVQSRVGDSFYIRTHFELEPSPPYG-LGFTRGDVFHVVDTLYPGSGPGHGHS 516

  Fly   761 GVVGSWQVLKIGRGHQEMQRGVIPNKSRAEELATAQFNATKKEMN-------ANESRGNFFR--- 815
            ...|.|...::||..:|.:||||||:||||:||:.:  |.::...       .:..|..|:|   
Mouse   517 SHGGLWLAARMGRDLREQERGVIPNQSRAEQLASLE--AAQRAAGVGPGASVGSNPRAEFWRLRG 579

  Fly   816 RRRSTHRRSKSLSRENWDDVVFSDSISKFPAYERVVLRHPGFVRPVVLFGPVSDLARERLAKDFP 880
            .||.|.:.|...|||   |:........:|.|||||||...|.||||:.|||:|:|.::|..:.|
Mouse   580 LRRGTKKASTQRSRE---DLSALTRQGHYPPYERVVLREASFKRPVVILGPVADIAMKKLTTEMP 641

  Fly   881 DKFSTPLQDDDKSAATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNYAQFYPVVIFLKTD 945
            ::|...    :..:.|....:|::|..:|.:.:|.||||||:||:|::||||.|:||:|||...:
Mouse   642 EEFEIA----ESMSRTDSPSKIIKLDTVRVIAERDKHALLDVTPSAIERLNYVQYYPIVIFCAPE 702

  Fly   946 SKHVIKQLRHGLPKAAHKSSKKLLEQCQKLERVWSHIFSTQIAL-SDEESWYRKLRDSIDLQQSG 1009
            |:..:|.||..|..|:.:||::|..|.|||::...|:|:..|.| ...:|||::::..|..||:.
Mouse   703 SRPALKALREWLAPASRRSSRRLYAQAQKLQKHSGHLFTATIPLHGTSDSWYQEVKAVIQQQQAR 767

  Fly  1010 AVWMSESKPVESLSDDFLFP-----MTTSRLSYASSPESDLELSPGPSASLSLGNLPQLVKASSD 1069
            .:|.:|.: :.|.|:|...|     .::..||..|...||.|.:.|..|.......||.|.....
Mouse   768 PIWTAEDQ-LNSSSEDLDLPGHGLAASSGDLSCDSRTNSDYEDTDGEGAYTDREGGPQDVDEEVA 831

  Fly  1070 PSIATNQDN---LDRDRDIIGEG--LPPPYTVPYDHAVPANPNRRQTMDSSKY 1117
            |:.......   :|..:.::|.|  :...:....|.....:..|:.:|.:.|:
Mouse   832 PTALARSSEPVWVDDHQGLMGHGTTITDKWETQADSHYTQDQRRQDSMRTYKH 884

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492 43/85 (51%)
PDZ_signaling 396..477 CDD:238492 26/81 (32%)
PDZ_signaling 633..710 CDD:238492 41/79 (52%)
SH3_ZO 729..790 CDD:212793 30/71 (42%)
GuKc 831..1007 CDD:214504 68/177 (38%)
ZU5 2263..2351 CDD:279170
Tjp3NP_001269025.1 PDZ_signaling 19..99 CDD:238492 43/85 (51%)
PDZ_signaling 194..270 CDD:238492 25/80 (31%)
PDZ_signaling 378..443 CDD:238492 37/65 (57%)
SH3 473..546 CDD:302595 33/74 (45%)
GuKc 589..765 CDD:214504 71/183 (39%)
Guanylate_kin 620..764 CDD:279019 57/148 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115544735
eggNOG 1 0.900 E1_KOG3580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6759
OMA 1 1.010
OrthoDB 1 1.010 D1175136at2759
OrthoFinder 1 1.000 FOG0001893
OrthoInspector 1 1.000 T615128
orthoMCL 1 0.900 OOG5_129845
Panther 1 1.100 LDO PTHR13865
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3326
TreeFam 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.