DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pyd and Tjp2

Sequence 1:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_006231237.1 Gene:Tjp2 RGDID:619807 Length:1257 Species:Rattus norvegicus

Alignment Length:1319 Identity:388/1320 (29%)
Similarity:579/1320 (44%) Gaps:357/1320 (27%)


  Fly   242 DRTTWEYHTVAVTRVPGYGFGIAVSGGRDNPHFANGDPSIAVSDVLKGGPAEDRLQVNDRIISVN 306
            :...||.:||.:.:....|||||||||||||||.||:.||.:||||.||||:..||.|||::.||
  Rat    93 EEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVN 157

  Fly   307 GVSLENVEYATAVQVLRDSGNTVQLVVK--RRVPLNPINAAGAVQHQ------------------ 351
            |..:|:|.::.|||.||.||....:|||  |:|.:.|:..:..:.|.                  
  Rat   158 GTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQVAPLQGSPPLSHDDRGFEMMDEFDGRSFRSG 222

  Fly   352 -----------------------------------------------------HSHSLSSVGLMA 363
                                                                 .||..|....:.
  Rat   223 YSERSRHSSHDMLSHSWEDSRERGRPHQRAQSRERERSRGRSLERGLDHEDYGRSHERSRGRSLE 287

  Fly   364 NG------------------------------------SGGVAPT------PITSLSQPNS---L 383
            .|                                    .|..:|:      |.|...:..|   |
  Rat   288 RGLDRDFVSRDYSRGRSIDRDYDRDYERSYHQAYEPDYEGRYSPSYDRRAHPETRYERSRSREHL 352

  Fly   384 NS------SLVQNASSGQ-----PIKVTLTKGGKKDDYGVVLGCRLFVKEISSKAREQLNANGYS 437
            .|      |..:....||     ||.|.|||....::||:.||.::|:||::   |..|.....:
  Rat   353 RSRSPTPESRSRQEHKGQHDPDRPIGVLLTKSKANEEYGLRLGSQIFIKEMT---RTGLATKDGN 414

  Fly   438 LQEGDIITRIHNTNCGDTMSLKEAKKIIDGCKERLNLVVLRDITNQTAVSQLNLNNSAS------ 496
            |.|||||.:|:.| ..:.|||.:|:|:|:..:.:|.|||||| :.||.::..:||:|.|      
  Rat   415 LHEGDIILKINGT-VTENMSLTDARKLIEKSRGKLQLVVLRD-SKQTLINIPSLNDSDSEVEDIS 477

  Fly   497 --------------HQASGNIYATHQPQVSGCSSSNNNLEDPYLPGGASYSSQNLYVQPPTRTSN 547
                          .|.|...|.:...::....||...........||:          ||...:
  Rat   478 EIESNRSFSPEERRQQYSDQEYHSSTEKLKERPSSREETSGRMSRMGAT----------PTPFKS 532

  Fly   548 GPNINGNGLNDEKSNLTPRGRSRGPIMDGVSLQQLDRPVTPTRGRSAAIDEPPRPPPPRGSSGGA 612
            ..:|...|:.:  :|..||.:...|:           |...|..|...     ||.|        
  Rat   533 TGDITAAGVTE--ANKEPRSQEESPV-----------PQPRTASRVFL-----RPSP-------- 571

  Fly   613 AQEDFYSSRRQLYEERQSAEPRFISFQKEGSVGIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDK 677
              ||         |.......:.:.|:|..|||:||.|||:.||||..:|.|:.|..:||..||:
  Rat   572 --ED---------EAIYGPNTKMVKFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQ 625

  Fly   678 ILKVNDMDMNGVTREEAVLFLLSLQ--DRIDLIVQYCKEEYDEVVTNQRGDSFHIKTHFHCDNPS 740
            |||||..|..|:.||:|||:||.:.  :.:.::.|...:.|.:::...|||||.|::||.|:..:
  Rat   626 ILKVNTQDFRGLVREDAVLYLLEIPKGETVTILAQSRADVYRDILACGRGDSFFIRSHFECEKET 690

  Fly   741 KGEMAFKAGDVFRVIDTLHNGVVGSWQVLKIGRGHQEMQRGVIPNKSRAEELATAQFNATKKEMN 805
            ...:||..|:||||:|||::|.:|.|..::||   .|:::|:||||||||::|:.| ||.::  |
  Rat   691 PQSLAFTRGEVFRVVDTLYDGKLGHWLAVRIG---NELEKGLIPNKSRAEQMASVQ-NAQRE--N 749

  Fly   806 ANESRGNFFRRR--RSTHRRSKSLSRENWDDVVFSDSIS-KFPAYERVVLRHPGFVRPVVLFGPV 867
            |.: |.:|:|.|  ||..:::...|||   |:..:.|:| ||||||:|:||..||.||||||||:
  Rat   750 AGD-RADFWRMRGQRSGVKKNIRKSRE---DLAAAVSVSTKFPAYEKVLLREAGFKRPVVLFGPI 810

  Fly   868 SDLARERLAKDFPDKFSTPLQDDDKSAATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNY 932
            :|:|.|||..:.||.|.| .:.:.|.|.:.....:|||:.:|.::::.||||||:||.|||.|||
  Rat   811 ADIAMERLTTELPDLFQT-AKTEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNY 874

  Fly   933 AQFYPVVIFLKTDSKHVIKQLRHGLPKAAHKSSKKLLEQCQKLERVWSHIFSTQIAL-SDEESWY 996
            .|::|:|||...||:..||.:|..|...::|||:||.:|..||::..||:|:..|.: |..:.|:
  Rat   875 TQWFPIVIFFNPDSRQGIKTIRQRLNPTSNKSSRKLFDQANKLKKTCSHLFTATINVNSANDGWF 939

  Fly   997 RKLRDSIDLQQSGAVWMSESKPVESLSDD------FLFPMTTSRLSYASSPESDLELSPGPSASL 1055
            ..|:|||..||:.|||:||.| :|.:.||      :|..|....||..|...||.|.:.|...:.
  Rat   940 GSLKDSIQQQQNEAVWVSEGK-MEGMDDDAEDRMSYLTAMGADYLSCDSRLISDFEDTDGEGGAY 1003

  Fly  1056 SLGNLPQ-----LVKA---SSDPSIATNQDNLDR-------------DRDIIGEGLPPPYTVPYD 1099
            :...|.:     ||.:   ||:|  ..:::::.:             .||.:.:|.|||...|..
  Rat  1004 TDNELDEPAEEPLVSSITRSSEP--VQHEESIRKPSPEPRAQMRRAASRDQLRDGSPPPAFKPEP 1066

  Fly  1100 HAVPANPNRRQTMDSSKYSI---YGTNVPPQQQQPGVGGDT------AAVRPQSLYGINAPDLPP 1155
            ..| .|.||..:.:.||.::   .|:.:|        ||.|      .||:|.....|..|..| 
  Rat  1067 PKV-RNQNREDSFNYSKSNLSAMAGSEIP--------GGSTKGCPPPIAVKPAFGRSILKPSTP- 1121

  Fly  1156 RIDRQSKPGDIPLNTSGSSSRNGTLGRSAQERLFGKAVVQDDVQAEYITRNALVGSGAAETLDRQ 1220
                      :|:..|..      :|.|.:|        |::.....:.|..:.     |.:|.:
  Rat  1122 ----------VPMPESEE------VGESTEE--------QEEAPKSVLGRVKIF-----EKMDHK 1157

  Fly  1221 QQQQQQTHASLERQARLNAQLKANGVGAGGGGASTYDSVSSYDSYNNTQMAMQNLGRLGPNAPDD 1285
            .:.|:..    |.|...||::                           ::|.::         .|
  Rat  1158 AKLQRMQ----ELQEAQNARI---------------------------EIAQKH---------PD 1182

  Fly  1286 LKSVPNANGRPLPPTG-QSHEYGRTPHDHRSFGGPNDLNRQSSPGRPHYHDMNASRNIDPRNGTP 1349
            :.:||..  .|.|..| ..|...|.|..            |.:|.| .|.|...|...||.....
  Rat  1183 IYAVPIK--APKPDAGLPQHMSSRPPEP------------QKAPSR-LYQDTRGSYGSDPEEEEE 1232

  Fly  1350 QRP-----SNLGLESSPRK 1363
            .|.     |..|..|.|.:
  Rat  1233 YRQQLAAHSKRGYYSQPSR 1251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492 48/85 (56%)
PDZ_signaling 396..477 CDD:238492 33/81 (41%)
PDZ_signaling 633..710 CDD:238492 35/79 (44%)
SH3_ZO 729..790 CDD:212793 28/61 (46%)
GuKc 831..1007 CDD:214504 81/178 (46%)
ZU5 2263..2351 CDD:279170
Tjp2XP_006231237.1 PDZ_signaling 100..185 CDD:238492 48/85 (56%)
DUF1777 276..>376 CDD:285811 14/100 (14%)
PRP38_assoc <278..356 CDD:289628 10/78 (13%)
PDZ 379..456 CDD:214570 34/82 (41%)
PDZ_signaling 581..658 CDD:238492 35/77 (45%)
SH3_ZO-2 675..737 CDD:212960 32/65 (49%)
GuKc 771..950 CDD:214504 84/183 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115499297
eggNOG 1 0.900 E1_KOG3580
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1175136at2759
OrthoFinder 1 1.000 FOG0001893
OrthoInspector 1 1.000 T617239
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13865
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.